(data stored in ACNUC7421 zone)

EMBL: CP000094.PE86

CP000094.PE86        Location/Qualifiers
FT   CDS_pept        complement(92064..92810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0086"
FT                   /product="putative membrane-bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71830"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK76"
FT                   /protein_id="ABA71830.1"
FT                   /translation="MSDEDRDNPRREFLRKSLTLIPVVTLAGSGLGSTVLQAAPESAPA
FT                   TAPAKTAAVEASTYQPSYFTAEEWAFINAAVAQLIPNDAQGPGALEAGVPEYIDRQMNT
FT                   PYAAGALWYMQGPFNADAAPEMGWQSKLVPKEIYRLGIAATDQWAKSINGKTFAEQDSA
FT                   TRDDLLKQLEAGKPQFDAVPAKIFFSLLLQNTKEGFFCDPIHGGNKGMVGWTMIGFPGA
FT                   RADFMDWVERNEQYPFPAVSIRGKRA"
     atgtctgatg aagatcgaga caacccgcgg cgtgagtttt tgcgcaaatc cctgaccctg        60
     attccggtcg tgactctggc cggcagcggt ctcggcagca cggtgctgca agccgcgcct       120
     gaaagcgcgc ctgccacagc gccggcgaaa acggccgccg ttgaagccag cacttatcag       180
     ccgagctact tcactgccga agagtgggcg ttcatcaatg ccgccgtcgc gcaattgatc       240
     cccaacgatg cgcaaggccc aggtgcgctc gaggccggcg tgccggaata catcgaccgt       300
     cagatgaaca cgccgtacgc cgccggtgcc ctctggtaca tgcaagggcc attcaacgcc       360
     gacgctgcgc ccgagatggg ctggcagagc aaactggtgc caaaagagat ctatcgcctc       420
     ggcattgccg ccacggatca gtgggcaaaa tccatcaacg gtaaaacatt tgccgagcaa       480
     gacagcgcta cccgagacga tctgctcaag cagcttgaag ccggaaaacc gcaattcgac       540
     gcggttccgg cgaagatttt cttcagtctg ctgttgcaga acaccaagga agggttcttc       600
     tgcgacccga tccacggcgg caataaaggc atggtcggct ggaccatgat cggcttcccc       660
     ggcgcccgcg ccgatttcat ggattgggtg gaacgcaacg agcaataccc cttcccggca       720
     gtttcgattc gcggcaagag ggcgtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page