(data stored in ACNUC7421 zone)

EMBL: CP000094.PE87

CP000094.PE87        Location/Qualifiers
FT   CDS_pept        93107..93751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0087"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71831"
FT                   /db_xref="GOA:Q3KK75"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK75"
FT                   /protein_id="ABA71831.1"
FT                   /translation="MFLTRFSSVLCLSLLALFGWTSAQAADTLASRPVEWAQPVEVQYN
FT                   LFQMSPTLYRSALPDDGAVPLLNNLKVVTVINFLPEADSNWLKAPGIHQVQLPYRTNHV
FT                   DDSDVLKTLRAIQSAEAEGPVLMHCKHGSDRTGLMAAMYRIVVQGWSKEDALNEMTQGG
FT                   FGESGHFRDSVRYVMQADVDKLRTALANGDCSTSAFATCSMKSWFQTVNLK"
     atgttcctga cgcgtttttc ctccgtactc tgtttgtcgc tgcttgccct gttcggctgg        60
     acttcagctc aagccgcgga cactctggct tcccgtcccg tcgagtgggc gcaaccggta       120
     gaagtgcaat acaacctgtt ccagatgtcg cccacgcttt accgcagtgc actccccgat       180
     gacggcgcgg tgccgttgct gaacaacctg aaggtggtca cggtcatcaa cttcctgccg       240
     gaagcggatt ccaactggct gaaagccccc ggtatccatc aggtgcaatt gccctatcgc       300
     accaatcacg tggacgacag tgatgtgctc aagaccctgc gtgccattca gtccgccgaa       360
     gccgaaggcc cggtgctgat gcactgcaag cacggctccg atcgcaccgg cctgatggcg       420
     gcgatgtacc ggatcgtcgt gcagggctgg agcaaggaag acgccctgaa cgaaatgacc       480
     cagggcggct ttggcgagag tgggcacttc cgggacagcg tgcgctacgt gatgcaggcc       540
     gatgtcgaca agttgcgcac cgcgctggcc aatggcgatt gcagcaccag cgcgtttgcc       600
     acgtgctcga tgaagagctg gtttcagacg gtcaatctga agtaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page