(data stored in ACNUC7421 zone)

EMBL: CP000094.PE91

CP000094.PE91        Location/Qualifiers
FT   CDS_pept        98321..98866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71835"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK71"
FT                   /protein_id="ABA71835.1"
FT                   /translation="MSLRKYQNHTPRLGQGAFVDGSAVVIGDVEIGEDSSVWPLTVIRG
FT                   DMHRIRIGARTSVQDGCVLHITHAGPFNPDGFPLLIGDDVTIAHKVMLHGCTVGSRVLI
FT                   GMGSIVMDGAVVEDDVIIGAGSLVPPGKHLESGFLYVGSPVKQIRQLTDKENAFFTYSA
FT                   ANYVKLKDLHLAEGYDQL"
     gtgtcccttc gcaagtacca gaatcacacc ccacgcttgg gccaaggcgc ttttgtcgac        60
     ggctcggcgg tggtgatcgg cgacgtcgaa atcggcgaag atagctccgt gtggccgctg       120
     accgtgatcc gtggcgacat gcaccgcatc cgtatcggcg cgcgcaccag cgtgcaggac       180
     ggctgcgtgt tgcacattac ccacgccggc ccgttcaacc cggacggctt cccgctcctg       240
     atcggcgatg acgtgaccat cgcccacaag gtcatgctgc acggctgcac cgtcggcagc       300
     cgcgtgttga tcggcatggg cagcatcgtc atggacggcg cggtggtcga ggacgacgtg       360
     atcatcggcg ccggcagcct ggtgccaccg ggcaagcatc tggaaagcgg ctttctgtac       420
     gtcggcagtc cggtgaaaca gatccgccag ctgaccgaca aggaaaacgc ctttttcacc       480
     tacagcgcgg cgaactacgt gaagctcaag gacctgcatc tggctgaagg ctacgaccag       540
     ctctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page