(data stored in ACNUC7421 zone)

EMBL: CP000094.PILM

CP000094.PILM        Location/Qualifiers
FT   CDS_pept        461682..462746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="Pfl01_0405"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72149"
FT                   /db_xref="GOA:Q3KJA7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA7"
FT                   /protein_id="ABA72149.1"
FT                   /translation="MLGLFNKKANTLLGIDISSTSVKLLELSRQGERYRVEAYAVEPLP
FT                   ANAVVEKNIAELEGVGQALSRVLVKARTGLKTVAVAVAGSAVITKVIEMDAGLSDDELE
FT                   NQLKIEADQYIPYPLDEVAIDFEVQGVSPRNPERVNVLLAACRKENVEVREAALALAGL
FT                   TARVVDVEAYALERSFGLLATQLAASQDRLTVAVVDIGATMTTLSVLHNGRIIYTREQL
FT                   FGGRQLTEEIQRRYGLTLEQAGLAKKQGGLPDDYVSEVLQPFREALVQQVSRSLQFFFA
FT                   SGQYNAVDHILLAGGTASVPGLDRLIEERLHTPTQVANPFSDMALSSKVNAGALASDAP
FT                   ALMIACGLALRSFD"
     gtgctaggac tcttcaataa aaaggccaat acgttactgg ggatcgacat cagctccaca        60
     tcggtcaagc tgctggagct gagccgtcag ggtgagcgct accgggtcga ggcgtacgcg       120
     gtggagccgt tgccggcgaa cgccgtggtc gaaaagaaca tcgccgagct cgagggcgtt       180
     ggccaggctc tgtcccgggt gctggtcaag gcgcgcaccg ggctgaaaac cgtggcggtg       240
     gcggtggctg gatctgcggt gatcaccaag gtcatcgaga tggacgccgg gctgtccgac       300
     gacgagctgg aaaaccagct caagatcgaa gccgatcaat acattcccta tccgctggac       360
     gaggtcgcca tcgacttcga agtccagggc gtttcgccgc gcaaccccga acgggtcaac       420
     gtgctgctgg ccgcctgtcg caaggaaaac gtcgaagtcc gcgaagcggc gctcgctctc       480
     gccgggctga ccgcgcgggt ggtggatgta gaggcgtatg cgctggagcg ctcgttcggc       540
     ctgctggcca cgcaactggc cgcgtcccag gatcggttga cggtggcggt ggtcgacatc       600
     ggcgccacca tgaccaccct cagcgtcctg cacaacggcc ggatcatcta cacccgcgaa       660
     caactgttcg gcggtcgaca gctgaccgag gaaatccagc gccgttacgg cctgaccctt       720
     gagcaggcgg ggctcgccaa aaagcagggc ggcctgccgg acgactacgt cagtgaggtg       780
     ctgcagccat ttcgcgaggc gctggtacag caggtgtcgc gctccctgca gttctttttc       840
     gcctccggcc agtacaacgc tgtcgaccac attctgctgg ccggcggcac ggcgtcggtg       900
     cccggccttg accggctgat cgaagagcgc ctgcacaccc cgacccaggt tgccaacccg       960
     ttttccgaca tggccttgag cagcaaggtc aacgccgggg ccctggcgag cgatgcgccg      1020
     gccctgatga ttgcctgcgg gctcgcgctc aggagtttcg actga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page