(data stored in ACNUC7421 zone)

EMBL: CP000094.RFAP

CP000094.RFAP        Location/Qualifiers
FT   CDS_pept        542658..543464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaP"
FT                   /locus_tag="Pfl01_0468"
FT                   /product="lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72212"
FT                   /db_xref="GOA:Q3KJ44"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ44"
FT                   /protein_id="ABA72212.1"
FT                   /translation="MKLMLAEPFKSLWAGRDPFAEVEGLQGEVYRELEARRTLRTEVDG
FT                   NGFFVKIHRGIGWGEIFKNLLTAKLPVLGAGQEWKAIQRLQEVGVPTMTAVAYGEKGSN
FT                   PADQHSFIVTEELAPTISLEDFSIDWVKQPPQPKLKRALIAEVARMTGMMHRAGVNHRD
FT                   CYICHFLLHTDKPVTPEDFKLSVIDLHRAQTRPAITQRWRNKDLAALYFSALDIGLTRR
FT                   DKLRFLKGYFQQPLRRILAEEAPLLSWLEGKANKLYARKQRYGDAL"
     atgaagttga tgctggctga accgttcaag agcctgtggg ccggacgcga tccgttcgcc        60
     gaggtcgagg gcttgcaggg cgaggtgtac cgcgaactgg aagcccgccg gacgttacgc       120
     acggaagtcg acggcaatgg ctttttcgtc aagatccacc ggggcatcgg ttggggcgag       180
     atcttcaaga acctgctgac cgccaagctg ccggtactcg gcgcgggcca ggaatggaaa       240
     gccatccagc gcttgcagga agtcggcgtg ccgaccatga ccgccgtcgc gtacggcgag       300
     aagggcagca acccggcgga tcagcattcg ttcatcgtta ccgaagagct ggcgccgacc       360
     atcagtctcg aagacttcag catcgactgg gtcaagcaac cgccgcagcc gaaactcaag       420
     cgggcgctga tcgccgaggt tgcgcgcatg accggcatga tgcaccgcgc cggggtcaac       480
     caccgcgact gctacatctg ccactttctg ctgcacaccg acaaaccggt cactcccgaa       540
     gatttcaaac tttcggtgat cgacctgcac cgtgcccaga cccgcccggc gatcacccag       600
     cgctggcgca acaaggatct ggcggcgctg tacttttccg cgctggacat cggcctgacc       660
     cgtcgcgaca agctgcgttt tctcaaaggc tattttcagc aaccgctgcg ccggatcctg       720
     gccgaagaag cgccgttgct gagctggctt gaaggcaagg ccaacaagct ctacgcgcgc       780
     aagcagcgtt acggggatgc gctctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page