(data stored in ACNUC7421 zone)

EMBL: CP000094.TATA

CP000094.TATA        Location/Qualifiers
FT   CDS_pept        complement(437342..437620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="Pfl01_0382"
FT                   /product="putative Sec-independent protein translocase
FT                   protein, TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72126"
FT                   /db_xref="GOA:Q3KJD0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJD0"
FT                   /protein_id="ABA72126.1"
FT                   /translation="MGIFDWKHWIVILVVVVLVFGTKKLKNLGTDVGESIKGFRKAMND
FT                   DEKPADPTVTPAQPVPPVQPQATAQANPPHTIDVQAQKVEEPIRKDV"
     atgggcattt ttgactggaa acactggatc gtcatcctgg tggtcgtggt actggtgttc        60
     ggtaccaaga aactgaagaa cctcggcacc gacgttggcg agtcgatcaa gggcttccgt       120
     aaagccatga acgacgacga aaaaccggcc gatccgaccg tcacgcctgc gcaaccggta       180
     ccgccggtac agccgcaagc caccgctcag gccaacccgc cgcacaccat cgacgtgcag       240
     gcgcagaaag tcgaagagcc gatccgcaaa gacgtgtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page