(data stored in ACNUC7421 zone)

EMBL: CP000094.TATB

CP000094.TATB        Location/Qualifiers
FT   CDS_pept        complement(436885..437331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="Pfl01_0381"
FT                   /product="Sec-independent protein translocase protein,
FT                   TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72125"
FT                   /db_xref="GOA:Q3KJD1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJD1"
FT                   /protein_id="ABA72125.1"
FT                   /translation="MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWVGRLKRSFNA
FT                   IKQEVEREIGADEIRRQLHNEHILSLEQEARKIFTPVQQEPTPVEHVGEQTIHSPAAPT
FT                   PAAPAVAPTESAPVVAPASVEHVAQTAAPTTPAPNDTTQPPRAP"
     atgtttggta tcagcttctc tgaactgctg ctcgtcggcc tcgtcgccct gctggtgctg        60
     ggccccgagc gtctgccggg cgctgcacgc accgccggcc tgtgggtcgg gcggctgaag       120
     cgcagcttca acgcgatcaa acaggaagtt gagcgtgaaa tcggtgccga cgaaatccgt       180
     cggcaactgc acaacgagca catcctgtca ctggaacagg aggcgcggaa gattttcacg       240
     ccggttcagc aggagccgac gccggtcgag cacgtgggtg agcagacgat tcacagccct       300
     gccgctccaa cgccagcggc acctgctgta gcgccaaccg aatcagcgcc tgtcgtcgcg       360
     ccagcctcgg ttgaacacgt agcccaaacc gccgcgccga ccacaccagc gccaaacgac       420
     accactcagc cgccgcgagc cccatga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page