(data stored in ACNUC7421 zone)

EMBL: CP000094.YGAU

CP000094.YGAU        Location/Qualifiers
FT   CDS_pept        329309..329749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaU"
FT                   /locus_tag="Pfl01_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72026"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN0"
FT                   /protein_id="ABA72026.1"
FT                   /translation="MSLLSFVKEAGEKLLDLLTPGNANASEQLKEHISKVGLGNPNVQA
FT                   TVDGDKVTVTGEVASQEEKEKILLAVGNIEGVGSVDDQITVTGPVVAAARFVVVKKGDT
FT                   LSAISLAVYGNANQYNKIFEANKPMLKDVNKIYPGQTLRIPE"
     atgagtcttt tgagctttgt gaaagaggcc ggtgagaagt tgctcgacct gttgaccccc        60
     ggcaacgcca atgccagcga gcaattgaag gaacatatca gcaaggtcgg gttgggtaac       120
     ccgaatgttc aggcgacggt ggatggcgac aaggtgacgg tcaccggcga ggtggcgagc       180
     caggaagaga aagagaagat tctgctggcg gtgggcaata ttgaaggcgt cggcagtgtc       240
     gatgaccaga tcacggtcac tgggccagtg gtggctgccg cacgtttcgt agtggtgaaa       300
     aagggcgaca ccctcagcgc gatttccctg gcggtgtatg gcaatgccaa ccagtacaac       360
     aagatcttcg aggcaaacaa gccaatgctc aaggatgtga acaagatcta tccggggcag       420
     acgctgcgca ttcccgagta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page