(data stored in ACNUC30630 zone)

EMBL: CP000113.GYRB

CP000113.GYRB        Location/Qualifiers
FT   CDS_pept        312232..314679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MXAN_0264"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87299"
FT                   /db_xref="GOA:Q1DFM8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM8"
FT                   /protein_id="ABF87299.1"
FT                   /translation="MEKTPATGSAVAPPPVEYGTDSITKLEGREAVRKRPGMYIGDTMA
FT                   YGLHKLVYEVVDNAVDESLAGHCTDIEVVIHVDGSLSVQDNGRGIPVGPHPKFPGKDTL
FT                   EVVLTELHAGSKFGNGAYKVSGGLHGVGVTCVNFLSEWFKVRVHRNGIVYEQAYAQGVP
FT                   DTPPREVGTTDKRGTHIAFKPDATVMELVEFNFETLSQRLRELAFLNAGLHIVVRDERT
FT                   NKEHDFKFDGGISSFVEYLNKSKQTLHDKPISFSTEREGVMLDIAMQWNDGYDERIYTF
FT                   ANNINTHEGGSHLSGFKAALTRTLNSYAEKGSLWKDLKETPTGEDAREGLSAVISVKLT
FT                   NPQFEGQTKTKLGNSEVKGLVEQMVNDQLGSFLEETPMVAKKVVAKIGDACRARLAARK
FT                   ARETVRRKGVLDGGGLPGKLADCQSRDPNESELYIVEGDSAGGSAKQGRDRRNQAILPL
FT                   RGKILNVEKARFEKMLTSAEIVTLITALGTGIGAEDYDPEKARYHRIILMTDADVDGSH
FT                   IRTLLLTFFFRQMPELLQKGYLYIAQPPLYKVTRNKKDQYVKDEHALNEYLLKIASEHA
FT                   RVLTPGGELGGAELKALLEKVITYEERLEKQAKRRDARVVDALVQGARLSAETLTDEAA
FT                   LEAAVKAAYDTFERRMPDVLGRVRHELVQDPEHHTKKLVFHTDVNGAMRETVLDHAFLS
FT                   SPEYLELSSLRDAFVALGKAPYKVRVDAGEITVFSVQEVLAAVRKDAQRGLGLQRYKGL
FT                   GEMNPEQLWDTTMNPATRTLLQVRVEDAVESDEIFSLLMGEAVEPRREFIERNALDVQN
FT                   LDI"
     atggaaaaga cccccgctac cggctcggcg gttgctccgc cgcccgtgga gtatgggacg        60
     gacagcatta ccaagctcga gggccgcgag gcggtccgga agcgccccgg catgtacatc       120
     ggcgacacga tggcctacgg gctccacaag ctcgtgtacg aggtcgtcga caacgcggtg       180
     gacgagtcgc tggccgggca ctgcaccgac atcgaggtcg tcatccacgt ggatggctcc       240
     ctgagcgtgc aggacaacgg gcgcggcatc cccgtgggcc cgcaccccaa gttccccggc       300
     aaggacaccc tggaggtcgt cctcacggag ctgcacgccg gcagcaagtt cggcaacggc       360
     gcgtacaagg tctccggcgg cctccacggc gtgggcgtca cctgcgtcaa cttcctctcg       420
     gagtggttca aggtccgcgt ccatcgcaac ggcattgtct acgagcaggc ctacgcgcag       480
     ggcgtcccgg acaccccgcc gcgcgaggtg ggcaccaccg acaagcgcgg cacgcacatc       540
     gccttcaaac cagacgccac ggtgatggag ttggtggagt tcaacttcga gacgctcagc       600
     cagcgtctgc gtgagctggc cttcctcaac gcgggcctgc atatcgtcgt ccgcgacgag       660
     cgcacgaaca aggagcacga cttcaagttc gacggcggca tctcctcgtt cgtggagtac       720
     ctcaacaagt cgaagcagac gctccacgac aagcccatct ccttcagcac ggagcgcgag       780
     ggcgtcatgc tcgacatcgc gatgcagtgg aatgacggct acgacgagcg catctacacc       840
     ttcgcgaaca acatcaacac ccacgagggt ggcagccacc tgtccggctt caaggcggcg       900
     ctgacgcgca cgctcaacag ctacgcggag aagggcagcc tctggaagga cctcaaggag       960
     acgcccaccg gcgaggacgc gcgtgaaggc ctgtccgccg tcatctccgt caagctgacc      1020
     aacccccagt tcgaggggca gacgaagacg aagctgggca acagcgaggt gaagggcctg      1080
     gtcgagcaga tggtgaacga ccagctcggc tccttcctgg aagagacgcc catggtcgcc      1140
     aagaaggtcg tggcgaagat tggcgacgcc tgccgggcgc gtctggccgc gcgcaaggcg      1200
     cgtgagacgg tgcgccgcaa gggcgtgctg gacggcggcg ggctccccgg aaagctggcg      1260
     gactgtcaga gccgcgaccc gaacgagagc gagctctaca tcgtggaggg cgactccgca      1320
     ggtggctccg cgaagcaggg cagagacagg cgcaaccagg ccatccttcc gctgcgcggc      1380
     aagattctca acgtggagaa ggcccgcttc gagaagatgc tcaccagcgc cgaaatcgtg      1440
     acgctgatta cggcattggg cacgggcatc ggcgcggagg actacgaccc ggagaaggcg      1500
     cgctaccacc gcatcatcct gatgacggac gccgacgtgg acggcagcca catccgtacg      1560
     ctgctgctca ccttcttctt ccggcagatg ccggagctct tgcagaaggg ctatctctac      1620
     atcgcgcagc cgccgctcta caaagtcacg cgcaacaaga aggaccagta cgtcaaggac      1680
     gagcacgcgc tgaacgagta cctgctcaag attgcctccg agcacgcgcg ggtgctgacg      1740
     cccgggggcg agctgggcgg cgcggagctg aaggcgctgc tggagaaggt gattacgtac      1800
     gaggagcgcc tggagaagca ggccaagcgc cgggacgcgc gcgtggtgga cgcgctggtg      1860
     cagggcgcgc gcctgtccgc ggagacgctg acggacgagg ctgccctgga ggcggcggtg      1920
     aaggccgcct atgacacctt cgagcgccgc atgccggacg tgctgggccg cgtgcgccac      1980
     gagctggtgc aggaccccga gcaccacacc aagaagctgg tgttccacac cgacgtgaat      2040
     ggcgccatgc gggagacggt gctcgaccac gccttcctgt cgtcgccgga gtacctggag      2100
     ctgtcgtcgc tgcgcgacgc cttcgtggcg ctgggcaagg cgccgtacaa ggtccgcgtg      2160
     gacgcggggg aaatcaccgt cttctccgtg caagaggtgc tcgccgccgt ccgcaaggac      2220
     gcgcagcgtg gcctgggcct gcagcgctac aagggtctgg gtgagatgaa cccggagcag      2280
     ctctgggaca cgacgatgaa cccggccacg cgcacgctgc tccaggtgcg ggtggaggac      2340
     gcggtggaga gcgacgaaat cttctcgctg ctgatgggcg aggcggtgga gccgcggcgc      2400
     gagttcatcg agcgcaacgc tctggacgtg cagaacctgg acatctga                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page