(data stored in ACNUC30630 zone)

EMBL: CP000113.KDPC

CP000113.KDPC        Location/Qualifiers
FT   CDS_pept        201586..202221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="MXAN_0166"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91913"
FT                   /db_xref="GOA:Q1DFX4"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFX4"
FT                   /protein_id="ABF91913.1"
FT                   /translation="MFSTFLTALRTCVVTMVLTGLLYPLAVTGLAQLLFPGEANGSWVK
FT                   DGRGRVVGSALIGQGFTRAGYFHPRPSAAGAGYDGAASSGSNLGPTSLKLKERAAAELE
FT                   RLRRENPDAAGPVPAELVTTSASGLDPHLSPEAARWQAARVARARGVALERVLDVVDAR
FT                   VEGRTFGVLGEPRVNVLLLNLALDRRFGPLPDAAPGVGGRASPGQGAP"
     atgttctcca cattcctcac ggccctgcgc acgtgcgtcg tcacgatggt gctcacgggg        60
     ctgctgtacc cgctggccgt caccgggctt gcgcagctcc tctttccggg ggaggccaat       120
     ggctcgtggg tgaaggacgg ccggggccgc gtggtgggca gcgcgctcat cggccagggc       180
     ttcacccggg cggggtactt ccatccgcgt ccttccgccg ctggcgcggg ctacgacggc       240
     gcggcgtcct cgggcagcaa cctggggccc acgtcgctga agctgaagga acgcgcggcg       300
     gccgagctgg agcgcctgcg ccgggagaat ccggatgcag cggggcccgt tcccgccgag       360
     ttggtgacga cgtccgcgtc tgggttggac ccccacctgt cgccggaggc ggcgcgctgg       420
     caggcggcgc gggtggcacg ggcccgcggc gtggcgctgg agcgggtgct ggacgtggtg       480
     gacgcgcggg tggaggggcg gaccttcggc gtgctgggcg agccgcgcgt caacgtcctg       540
     ctgttgaacc tcgcgttgga caggcgcttc gggccgcttc cggacgcggc gccgggcgtg       600
     gggggcaggg cctcgccggg ccagggcgca ccttga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page