(data stored in ACNUC30630 zone)

EMBL: CP000113.LGT

CP000113.LGT         Location/Qualifiers
FT   CDS_pept        complement(250000..250842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="MXAN_0205"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by similarity to SP:O34752; match to
FT                   protein family HMM PF01790"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88766"
FT                   /db_xref="GOA:Q1DFT6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT6"
FT                   /protein_id="ABF88766.1"
FT                   /translation="MGRSHPLEPPDVIPYWHAPSIELGPLKIEPFGILVAVGILLAARL
FT                   LGRNAEREGLNPEPLADFAPWGVGVGVVVGHWVHLFFYHPEELSKSPFQILKVWDGLSS
FT                   FGGLLGGILAAVVFFKVRKLRFSDYADSFALGVAPGWAVARLGCFAVHDHPGVPTDFFL
FT                   AVAFPGGPRHDLGMYDAMALFAISGVLYALRNAGKLKGRLLPLLAVLYAACRFFFDFLR
FT                   ATDMAYVDARYFGLTPAQYGCIALALYGIWGVLRPQAPGAASSPPPSSPKSPGTVGVR"
     gtgggacgtt cgcatcccct ggagccgcct gacgtgattc cctattggca cgccccctcg        60
     attgagctgg ggcccctgaa aatcgagccc ttcggcatcc tcgtcgcggt gggcatcctg       120
     ttggccgctc gcctgcttgg ccggaacgcc gagcgcgaag gcctgaaccc ggagccgctc       180
     gccgacttcg cgccctgggg cgtgggcgtc ggcgtcgtcg tgggccactg ggtgcacctg       240
     ttcttctacc acccggagga gctgtccaag agcccgttcc agattttgaa ggtctgggat       300
     ggcctgtcct cgttcggtgg ccttctgggc ggcatcctcg ccgccgtcgt gttcttcaag       360
     gtccgcaagc tgcgcttctc ggactacgcg gactcgttcg ccctgggcgt ggcgccgggc       420
     tgggcggtgg cgcggctggg ctgcttcgcc gtgcatgacc acccgggcgt gcccacggac       480
     ttcttcctgg cggtggcctt ccccggcggc ccccggcacg acctgggcat gtacgacgcc       540
     atggcgctct tcgccatcag cggcgtgctg tacgccctgc gcaacgcggg gaagctgaag       600
     gggcgcctgc tgccgctgct ggcggtgctg tacgcggcgt gccgcttctt cttcgacttc       660
     ctgcgcgcca cggacatggc ctacgtggac gcccgctact tcggactgac gcccgcgcag       720
     tacggctgca tcgcgctggc gctctacggc atctggggcg tcctgcggcc tcaggcgccg       780
     ggcgcggcct cctcgccgcc gccgtcgtcg ccgaagagcc cgggaacggt aggcgtgcgg       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page