(data stored in ACNUC30630 zone)

EMBL: CP000113.LSPA

CP000113.LSPA        Location/Qualifiers
FT   CDS_pept        434755..435351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="MXAN_0368"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="identified by similarity to SP:P17942; match to
FT                   protein family HMM PF01252; match to protein family HMM
FT                   TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86672"
FT                   /db_xref="GOA:Q1DFD1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD1"
FT                   /protein_id="ABF86672.1"
FT                   /translation="MKVSHRFVLLVIVAVLAADQVTKYLAVSRLTDALDGREGLARVTG
FT                   FVTEQNLDNRPPPEDGSYRVLRPYRFIEDYWHFRYVENPGAAWGIFGDMPEGVRRLFFL
FT                   VVSLAAMGFIFVMYRRTPMEQRLARVALALVTGGALGNFVDRLLRGYVIDFIDWHWRNQ
FT                   PGMRWPTFNVADVAISVGVGLMLLDSLRAPKSPNP"
     atgaaagtct cccatcgatt cgtcctcctc gtgattgtcg cggtgctcgc cgcagaccag        60
     gtgaccaagt acctagctgt ctctcggctg acggatgccc tggatgggcg ggaaggcctg       120
     gcgcgggtga cgggcttcgt caccgagcag aacctggaca accgcccgcc gcccgaggac       180
     ggctcgtacc gggtgttgcg gccctatcgc ttcatcgagg actactggca cttccgctac       240
     gtggagaacc cgggcgcggc ctggggcatc ttcggcgaca tgcccgaggg cgtgcgacgc       300
     ctcttcttcc tcgtggtgag tctggcggcc atgggcttca tcttcgtgat gtaccggcgc       360
     acgcccatgg agcagcggct ggcccgggtg gccctggcgc tggtgacggg tggtgcgctg       420
     ggcaacttcg tggaccggtt gttgcgtggc tacgtcatcg acttcatcga ctggcactgg       480
     cgcaaccagc cggggatgcg ctggccgacc ttcaacgtgg cggacgtggc catcagcgtc       540
     ggggtgggtc tcatgctgct ggactcgctg cgggcgccga aaagccccaa tccgtga          597
//

If you have problems or comments...

PBIL Back to PBIL home page