(data stored in ACNUC30630 zone)

EMBL: CP000113.PDXA

CP000113.PDXA        Location/Qualifiers
FT   CDS_pept        complement(530459..531499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="MXAN_0467"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91756"
FT                   /db_xref="GOA:Q1DF36"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF36"
FT                   /protein_id="ABF91756.1"
FT                   /translation="MGLPHVGISLGDVSGIGPEVTAAALTKPSVRKVLVPVIFGDGPTL
FT                   ARFPAFRRYARVEPSALGRVEGPTVVEVTRLAEKDRVPGEPSREGGRAQYAFVTAAIDA
FT                   MRAGHVDALCTAPVSKEQISRAGIPFMGHTEVLAEAFGVDVMMLMDGPRVRVALATNHV
FT                   PLADLPRLLTVDGLTAQLKLLSRSLEPVVGHKPRIAVLGLNPHAGEGGLLGREEVEVIG
FT                   PAIRKARAARVDANGPIPADGLFAKPDEVGARYDAVLAMYHDQGLIPAKALDFERTVNV
FT                   TLGLPVPRTSPDHGTAYAIAGKGEASCVPMVEALLKAAQLAGARLAHQATGRRARPGPL
FT                   RPSPGR"
     gtgggccttc cgcacgtcgg aatctccctg ggggacgtgt cgggcatcgg gccggaggtg        60
     acggccgcgg ccctgacgaa gccctccgtg cgcaaggtgc tcgtccccgt catcttcggg       120
     gacgggccca cgctggcgcg cttccccgcc ttccgccgct atgcccgcgt ggagccctcc       180
     gccctgggcc gcgtggaagg ccccaccgtg gtggaggtaa cgcggctcgc ggagaaggac       240
     cgcgtgcccg gagagccctc gcgcgagggc ggccgcgcgc aatacgcctt cgtgacggcg       300
     gccatcgacg cgatgcgggc cggacacgtg gacgcgctgt gcaccgcgcc cgtgtcgaag       360
     gagcagattt cccgcgcggg catccccttc atgggtcaca ccgaagtgct ggcggaggcc       420
     ttcggcgtgg acgtgatgat gttgatggat gggcctcgcg tgcgcgtggc gctcgccacc       480
     aaccacgttc ccctggcgga cctgccgcgc ctgctcaccg tggacggact gaccgcgcaa       540
     ctcaagctgc tgtcgcgcag cctggagccg gtggtgggcc acaagccgcg catcgccgtg       600
     ctggggctca acccgcacgc gggcgaaggt gggctcctgg gacgcgaaga ggtggaggtg       660
     attggccccg ccatccgcaa ggcccgcgcg gcccgggtgg acgcgaatgg gcccatcccc       720
     gcggacgggc tcttcgcgaa gcccgacgag gtgggcgcgc gctacgacgc ggtgctggcc       780
     atgtaccacg accaggggct catcccggcc aaggcgctgg acttcgagcg cacggtgaac       840
     gtgacgctgg gcctgcccgt gccgcgcacg tctcccgacc acggcacggc ctacgccatc       900
     gccggcaagg gtgaggcgag ctgcgtgccc atggtggaag cactgctcaa ggccgcccag       960
     ctcgcggggg cccgtcttgc acaccaggca accgggcgac gtgctcggcc aggtccgctc      1020
     cgtccttcgc cgggtcgatg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page