(data stored in ACNUC30630 zone)

EMBL: CP000113.PE101

CP000113.PE101       Location/Qualifiers
FT   CDS_pept        complement(118762..119688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0104"
FT                   /product="aminoglycoside phosphotransferase family protein"
FT                   /note="identified by similarity to GB:AAC14693.1; match to
FT                   protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88549"
FT                   /db_xref="GOA:Q1DG36"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG36"
FT                   /protein_id="ABF88549.1"
FT                   /translation="MAHDAEQSPALTDAEAAERIHARFPALATARVVRLGEGTDHQAFE
FT                   VEGRYVFRFPKSDEAAEHLKWEARLLAWLGPRLPLPVPDYRFLAHPAADLAAGFAGYEK
FT                   LPGTPALLVEPERLDLSDLGRRLGAFLRALHALDPAEAAALGVPADDDPELEAWSAAAV
FT                   DDLRLAVEHSHMEPHRAADWEQRLRVRPTEGRGAPRLVHGDFAAEHVLVDSHGAPTGVI
FT                   DWSDACVGDPARDFAGLLHWGGAPMLTASLETYGAVSPAVLTRARWFAACRAVADIAFG
FT                   QTQGRPEYIAAGQRALTGLGKHPPFDA"
     atggctcacg acgcggaaca gtcacccgcg ctcacggacg cggaggccgc cgagcgcatc        60
     cacgcgcgct ttcccgcgct cgcgacggcg cgggtcgtcc gcctggggga aggcacggac       120
     catcaggcct tcgaggtgga ggggcgctac gtcttccgct tccccaagag cgacgaagcc       180
     gccgagcacc tgaagtggga ggcgcgcctg ctggcgtggc tcgggccccg gcttcccctg       240
     ccggtccccg actaccgttt cctcgcgcac cctgccgccg acctcgctgc gggcttcgcg       300
     ggctacgaga agctcccagg gacgcccgcg ctcctcgtcg agcctgagcg gctggacctg       360
     tcggacctcg gccgcaggct cggcgccttc ctgagagcgc tccatgcgct cgaccccgcc       420
     gaagccgctg cgctcggcgt gccggcggac gacgacccgg aactcgaagc gtggtcggcc       480
     gccgccgtgg acgatttgcg gctcgccgtc gaacacagcc atatggagcc gcaccgggct       540
     gcggactggg agcagcggct cagggtgcgc cccacggagg gacgcggcgc tccccggctg       600
     gtccacggcg acttcgccgc ggagcatgtc ctggtcgatt cccacggtgc tcccacgggg       660
     gtcatcgact ggagtgatgc gtgcgtcgga gaccccgcga gggatttcgc cggactgctc       720
     cactggggcg gagcgcccat gctgaccgcc tcgctggaga cgtatggcgc ggtcagcccc       780
     gccgtcctca cgcgggcgcg gtggttcgcc gcctgccgcg cggtggccga catcgccttc       840
     ggccagacgc agggacggcc ggagtacatc gccgccgggc aacgggcgct caccggactt       900
     gggaagcacc cgcccttcga cgcgtaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page