(data stored in ACNUC30630 zone)

EMBL: CP000113.PE114

CP000113.PE114       Location/Qualifiers
FT   CDS_pept        complement(136328..139102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0117"
FT                   /product="serine/threonine kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P33973; match to
FT                   protein family HMM PF00069; match to protein family HMM
FT                   PF00515; match to protein family HMM PF07719; match to
FT                   protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90109"
FT                   /db_xref="GOA:Q1DG23"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG23"
FT                   /protein_id="ABF90109.1"
FT                   /translation="MTPGASAMSMRDSGRGRAGTGNREGDAFGTGPGSRRDDAPPVPQV
FT                   GRYFLLKRLGQGGMGVVYAAYDPDLDRKVALKLLHADSRTDSEEARARLLREAQAMARV
FT                   SHPNVIPIFDVDVWGDRVFLAMELVDGGTLASWVKEGQRSWREILESFLAAGRGLQAAH
FT                   EAGLVHRDFKPANVLVNKAGRVFVTDFGLARPVGTLPKEEPLSEDAEALIPSERRMLDT
FT                   PLTEAGLIIGTPSYMSPEQFRGDDLDPRSDQFSFCVALYWALYRQRPFEPAKMEAYASS
FT                   RKPQAQPVVEATEPLNVTAPLEREAPKPLPPPVLIQEPPRDVKVPAWVKQAMMRGLSLD
FT                   PAARFASMEALLGALSQEHRFTKRRRWVAGASTVAAGVALVGGVLYQQSQVCAAAGARM
FT                   DDVWSPAARQQVEAAFLATGKPFAQELAGKVSQVLDGYASAWKQQSTEACEATHVHGVQ
FT                   TEELLTRRTVCLARRHKDVRATVALLSSADASLVEKSVDAVHALPSLHECEDEESLAEQ
FT                   QRLPSDAAKRADIEKLEEQLAGVKALVDAGRYPKALETARALEAPVLATGHLPLTAELR
FT                   FHLGWLQEQNGQSPEASKQLFHAVRDAEAGRADRLKVAILNKLLYVEDGQQHFTQASDW
FT                   GELAHATLQRLGGEPVLEADVRMNQANLAVSQERFEDARTLLEQAKALQAHALPLGHPK
FT                   RARTTFLLGGVMLDLGKPEEAVKLLEEALTLTEAAVGPWHPDMAQRHGMLSLTLRELKQ
FT                   DAKALAHAQAAAQVRKATQGETSVLYAETLDEVGMCLHAMKRYDEALKAYEEALVIKRA
FT                   ALPADDERLQYSYDGVGQALLELGKANESVAPLRQAVSFASAPPDVLAESGFALARALW
FT                   MTQQPPAARGEAAQARARFTEAGLDARVADVDAWLSTLPPEPAPRPARRKPRR"
     gtgacgccgg gtgcatcggc catgagcatg agagacagcg gtagaggacg cgcgggcacg        60
     ggcaatcgag agggcgatgc cttcggcacc ggccctgggt cgcggcgcga cgacgcgcca       120
     cccgttcccc aggtggggcg ctacttcctc ctcaagcgcc tgggacaggg cggcatgggc       180
     gtggtgtacg ccgcctatga cccggacctg gaccgcaagg tggcgctcaa gctgctgcac       240
     gcggactcgc ggacggactc ggaggaggcc cgagcccggc tgctgcgcga ggcgcaggcc       300
     atggcgcgcg tctcgcaccc caacgtcatc cccatcttcg acgtggacgt gtggggtgac       360
     cgcgtcttcc tggccatgga gctggtggac ggcggcaccc tggcctcgtg ggtgaaggag       420
     gggcagcgct cctggcgaga gattctggag tccttcctcg ccgcgggccg ggggctccag       480
     gccgcgcacg aagccgggct ggtgcaccgc gacttcaagc ccgccaacgt gctggtgaac       540
     aaggcaggcc gcgtcttcgt caccgacttc ggcctggcgc ggccggtggg cacgctgccc       600
     aaggaggagc ccctctccga ggacgcagag gccctcattc cctccgagcg gcgcatgctg       660
     gacacgcccc tcaccgaggc gggcctcatc atcggcacgc ccagctacat gtccccggag       720
     cagttccgtg gggatgacct ggacccgcgc tcggaccagt tcagcttctg cgtcgcgctg       780
     tactgggcgc tctaccgtca gcgccccttc gagcccgcca agatggaggc ctatgcctcc       840
     tcgcggaagc cccaggccca gcccgtggtc gaggccaccg agccgctgaa cgtgacggcg       900
     cccctggagc gagaggcccc caagcccctg ccgccgcccg tcctcatcca ggagccgccg       960
     cgcgacgtga aggtccccgc ctgggtgaag caggcgatga tgcgcggcct gtcgctggac      1020
     ccggccgcgc gcttcgcgtc catggaggcg ctgctcggcg cgctgtcaca agagcaccgc      1080
     ttcacgaagc gccggcgctg ggtggcgggc gcgagcaccg tggcggcggg cgtggccctg      1140
     gtgggcggcg tcctctacca gcagtcccag gtctgcgcgg ccgcgggcgc gcgcatggat      1200
     gacgtctgga gcccggcggc gcggcaacag gtggaggcgg ccttcctcgc cactggcaag      1260
     cccttcgcgc aggagctggc cggcaaggtg tcccaggtgc tggacggcta cgcgagcgcg      1320
     tggaagcagc agagcaccga ggcctgcgaa gccacccacg tccacggcgt gcagacggag      1380
     gagctgctga cacggcgaac ggtgtgtctg gcgcggcggc acaaggacgt gcgcgccacg      1440
     gtggcgctgc tgtccagcgc ggacgcgtcg ctggtggaga agtcggtgga cgcggtgcac      1500
     gccctgccct cgctgcacga atgcgaggac gaggagtccc tggccgaaca acagcggctg      1560
     ccctcggacg cggcgaagcg cgccgacatc gagaagctgg aggagcagct cgcgggcgtg      1620
     aaggcgctgg tggacgcggg ccgctatccg aaagccctgg agacggcgcg cgcgctggag      1680
     gcaccggtgc tggccaccgg ccacctgccg ctcacggccg agctgcgctt ccacctgggc      1740
     tggctccagg aacagaacgg ccagtccccc gaggcgtcga agcagctctt ccacgccgtg      1800
     cgcgacgccg aggcggggcg ggcggaccgg ctgaaggtcg ccatcctcaa caagctgctc      1860
     tacgtggagg acggccagca gcacttcacc caggcctcgg actggggcga gctggcacac      1920
     gcgaccctcc agcgtctggg cggcgagccc gtgctggaag ccgacgtgcg gatgaaccag      1980
     gccaacctcg cggtgtcgca ggagcgcttc gaggatgcgc gcacgctgct ggagcaggcc      2040
     aaggcgctcc aggcccacgc cctgcccctg ggccacccca agcgcgcgcg aaccaccttc      2100
     ctgctgggcg gcgtgatgct ggacctgggg aagcccgagg aggcggtgaa gctgctggag      2160
     gaagcgctga cactgacgga ggccgcggtg ggcccctggc acccggacat ggcccagcgc      2220
     cacggcatgc tgtcgctgac gctgcgcgag ctgaagcagg acgccaaggc cctggcgcac      2280
     gcgcaggcgg cggcccaggt ccgcaaggcc acgcagggcg agacgagcgt cctgtacgcg      2340
     gagaccctgg acgaggtggg catgtgcctg cacgcgatga agcgctacga cgaggcgctg      2400
     aaggcctacg aagaggcgct ggtcatcaag cgcgcggcgc tacccgcgga cgacgagcgc      2460
     ctccagtact cctatgacgg cgtgggccag gcgttgctgg agctgggcaa ggcgaacgaa      2520
     tcggtggcgc cgctgcggca ggccgtctcc ttcgcgtcgg ccccgcccga cgtgctggcc      2580
     gagtccggct tcgccctggc tcgcgccctg tggatgacgc agcagccccc ggcggcccgc      2640
     ggggaggcgg cccaggcccg ggcgcgcttc accgaggccg gcctggatgc gcgggtggcg      2700
     gacgtggacg cctggctctc gacgctgccg cccgagcctg ccccccggcc cgcgcgacgc      2760
     aagccccggc ggtga                                                       2775
//

If you have problems or comments...

PBIL Back to PBIL home page