(data stored in ACNUC30630 zone)

EMBL: CP000113.PE119

CP000113.PE119       Location/Qualifiers
FT   CDS_pept        143467..144831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0122"
FT                   /product="putative GTP cyclohydrolase II"
FT                   /note="identified by similarity to SP:P17620; match to
FT                   protein family HMM PF00925"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92890"
FT                   /db_xref="GOA:Q1DG18"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG18"
FT                   /protein_id="ABF92890.1"
FT                   /translation="MVGPDRRLVDELKRAPRREAPPPAPRLCSRARKEGAPMAEKKNLN
FT                   HIRLTSHPDGDVPSVPIRWGDGEPTRRGPVVATLTEAGHRNVIGTHAGAYAVYRALAVA
FT                   AGMLPQDHRADLKNTAPAAQVGPHPSWSDPQRIVSLDPWGAIAPQAFRPFAEQGIDFRP
FT                   TIAVTKAHINFPEVRDAIDAGRLTPDGDLLRGNGDIKVTKAAVDPVWYLPGIAKRFGMT
FT                   ESALRRGLFEQTGGMFPELITRPDLHVFLPPIGGLTLYVFGGIETLADRDVPLTVRVHD
FT                   ECNGSDVFGSDICTCRPYLAHGIEECVRTAQAGGAGLIVYLRKEGRALGEVTKFLVYNA
FT                   RKRQEGGDSAATYFQRTECVAGVQDMRFQELMPDVLHWLGITRIHRFVSMSDMKHDAIT
FT                   RSGIEILERVPIPDELIPADAKVEMEAKKAAGYFTQGPVADAAGLAQVKGRDLDV"
     gtggtcggcc cggaccgacg gctcgtggat gagctgaagc gcgccccacg acgcgaagca        60
     ccgccccccg caccccgact ttgctcccgc gcccgcaagg agggcgctcc catggccgag       120
     aaaaagaatc tcaatcacat ccgcctcacc tcccacccgg atggcgacgt ccccagcgtc       180
     cccatccgct ggggagacgg cgagccgacg cgccgcggcc ccgtcgtcgc cacgctgacg       240
     gaagccgggc accgcaacgt catcggcacg catgccggcg cgtatgccgt gtaccgcgcg       300
     ctcgccgtgg ccgcgggcat gctgccgcag gaccaccgcg ccgacctgaa gaacaccgcg       360
     cccgccgcgc aggtggggcc gcatccgtcg tggagcgacc cgcagcgcat cgtctcgctg       420
     gacccgtggg gcgccatcgc gccgcaggcg ttccggccct tcgcggagca gggcatcgac       480
     ttccggccga ccatcgccgt caccaaggcg cacatcaact tccccgaggt gcgcgacgcc       540
     atcgatgccg ggcgcttgac gccggacggg gacctgctgc gcggcaacgg cgacatcaag       600
     gtgaccaagg ccgcggtgga cccggtgtgg tacctgccgg gcatcgcgaa gcgcttcggc       660
     atgacggaga gcgcgctgcg ccgtggtctc ttcgagcaga cgggcggcat gttcccggag       720
     ctgattacgc gcccggacct gcacgtcttc ctgccgccca ttggcgggct gacgctgtac       780
     gtcttcggcg gcatcgagac gctggcggac cgggatgtgc cgctgacggt gcgcgtgcat       840
     gacgagtgca acggctccga cgtgttcggc agcgacattt gcacctgtcg gccctacctg       900
     gcgcacggca tcgaggagtg cgtacgcacc gcgcaggcgg gcggcgcggg gctcatcgtc       960
     tacctgcgca aggaaggccg ggcgctgggc gaggtgacga agttcctcgt gtacaacgcg      1020
     cgcaagcggc aggagggcgg cgactccgcg gccacctact tccagcgcac cgagtgcgtg      1080
     gccggcgtgc aggacatgcg cttccaggag ctgatgccgg acgtgctgca ctggctgggc      1140
     atcacccgca tccaccgctt cgtatcgatg agtgacatga agcacgacgc gattacgcgc      1200
     tcgggcattg aaatcctgga gcgcgtcccc atccccgacg agctcatccc cgccgacgcc      1260
     aaggtggaga tggaggcgaa gaaggccgcg ggttacttca cgcaagggcc ggtggcggac      1320
     gcggcggggc tggcgcaggt gaaggggcgg gacctcgatg tctga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page