(data stored in ACNUC30630 zone)

EMBL: CP000113.PE123

CP000113.PE123       Location/Qualifiers
FT   CDS_pept        147385..148707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0126"
FT                   /product="CapA family protein"
FT                   /note="identified by similarity to SP:P19579"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90603"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG14"
FT                   /protein_id="ABF90603.1"
FT                   /translation="MSASVLLLLPLLCASAPTRVELVFGGDVIPHGEVKDVARLHARTG
FT                   APPPEGGRAPSLNHEGWDHVFGPIADVLRTADVGVVNLETPVTDNTKAVARELLFNAPS
FT                   AMVHALASAGVKVVSTANNHARDQHPAGMLETLRHLDAAGIRHTGTGATKDAAWEPAFV
FT                   DVRGVKVGFLSFTRMLNGFSNPKDAQAPHVALVPYSGHETHRGIQPEQAVEAVRAAAAQ
FT                   CDALIVLAHWGTEYKGEPRPEDRELGRALLDAGARAVIGHHPHVLQPLESYQTVDGRKG
FT                   LIAYSLGNLVANQDRFYQHAAGTKSSGGDRRDSMLLRLSLVRPMPGVSVALEEVAVLPV
FT                   WIENNAVGRARNESRNIQPVLIDREVEEVTARLALLAARPAPLDKETRAQKALLERRLE
FT                   GSKHRRERILRMLPEGFAVASPELRQRGTAAVPPGRLASQP"
     gtgtccgcct ccgtcctgct gctgttgccc ctgctttgtg cctccgcccc cacgcgcgtg        60
     gagctggtgt ttggtgggga tgtgattccc catggcgagg tgaaggatgt cgcgaggctg       120
     cacgcccgca ccggggcgcc gccaccggaa ggaggccggg cgccctcgct caaccatgag       180
     ggctgggacc acgtcttcgg gcccatcgcg gacgtgctgc gcacggcgga cgtgggcgtc       240
     gtgaatctgg agacgcccgt caccgacaac acgaaggcgg tcgcgcggga gctcttgttc       300
     aacgcgccgt cggccatggt gcacgcgctg gcctcggccg gggtgaaggt ggtgtccacc       360
     gcgaacaacc acgcgaggga ccagcacccc gcgggcatgt tggagacgct gcggcacctg       420
     gatgcggcgg gcatccgtca tacgggcacg ggcgcgacga aggacgccgc gtgggagccc       480
     gccttcgtgg acgtgcgagg cgtgaaggtg gggttcctgt ccttcacgcg catgctgaat       540
     ggcttcagca atccgaagga tgcgcaggcg ccgcacgtcg cgctggtgcc ctattcgggg       600
     cacgaaacgc accgggggat tcagcccgaa caggccgtgg aagccgtgcg cgccgcggcg       660
     gcgcaatgtg acgcgctcat cgtgctggcg cactggggga cggagtacaa gggggagcca       720
     cggcccgagg accgtgagct gggacgcgcg ctgctggacg cgggggcgag ggcggtcatc       780
     gggcaccatc cgcacgtgct ccagccgctg gagtcgtacc agacggtgga tgggcgcaag       840
     gggcttatcg cgtactcgct gggcaacctg gtggcgaacc aggaccgctt ctaccagcac       900
     gcagcgggga cgaagagctc ggggggcgac cggcgggact cgatgttgct gcggctgtcg       960
     ctggtgcggc ccatgcccgg tgtgtcggtg gctctggagg aagtggcggt gctgccggtg      1020
     tggattgaga acaacgcggt ggggcgggcg cgaaatgagt cgcggaacat ccagccagtg      1080
     ctcatcgacc gggaggtgga ggaggtgacg gcgcggctgg cgttgctggc ggcgcgcccc      1140
     gcgcctctgg acaaggagac acgcgcgcag aaggccttgc tggagcggcg gctggaaggc      1200
     tccaagcacc ggcgtgagcg cattctccgg atgttgccgg aagggttcgc ggtggcgtcg      1260
     ccggagttgc gtcagcgcgg gacggcggcc gtgcctccag ggcggttggc ctcacagccg      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page