(data stored in ACNUC30630 zone)

EMBL: CP000113.PE128

CP000113.PE128       Location/Qualifiers
FT   CDS_pept        complement(153663..154964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0131"
FT                   /product="chloride transporter, chloride channel (ClC)
FT                   family"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86382"
FT                   /db_xref="GOA:Q1DG09"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG09"
FT                   /protein_id="ABF86382.1"
FT                   /translation="MNLSRGTRALMQWLLLGGLVGVVCGVASAVFLYLLDEATHFREGH
FT                   PWLVYALPVAGLVLGAVYGKWGRPIRGGNNLVLDTVHASDAQVPVRMAPMVLVGTVLTH
FT                   LFGGSAGREGTAVQMGGSLADLVARRFRVGPDTRRELLAAGIAGGFGSVFGTPVAGAVF
FT                   GLEVVVVGRMGYEALLPALVASVVGDMVTRGLGIHHTPYPAPGALPLTVAVLAKWLVFA
FT                   VAVAVVAVVFVELMHRLKKLLEQRVQVLPLRMALGGLAVLLLWLLAGTDDYLGLGVPGI
FT                   QRAFEDPALPVSAFAWKLAFTVVTLAAGFLGGEVTPLFFIGASLGNVLARLLGLPLDLG
FT                   AAVGMAALFAAAANTPLALSIMAVELLGANVLPHVAIVATVAYLLTGQRGIYPSQRIAR
FT                   MKHGGPLLEKLVALRELAREDRAPPSGPEGRGGG"
     gtgaatcttt cccgtggcac gagagcgctg atgcagtggc tgctcctggg tgggctggtg        60
     ggcgtcgtct gcggcgtggc atccgcggtc ttcttgtacc tgttggacga agcgacgcac       120
     ttccgggagg ggcacccgtg gctggtgtac gcgctgccgg tggcggggct ggtgctgggg       180
     gcggtgtacg ggaagtgggg taggcccatt cgcgggggca acaacctggt gctggacacg       240
     gtgcacgcga gcgacgcgca ggtgccggtg cgcatggcgc ccatggtgct ggtggggacc       300
     gtgctgacgc acctgttcgg cggcagtgcg ggccgcgagg gcacagcggt gcagatgggc       360
     ggcagtctgg cggacctggt ggcgcgacgc ttccgggtgg gcccggacac acgccgcgag       420
     ctgctggccg cgggcatcgc gggtgggttc ggttcggtgt tcggcacgcc ggtggcgggg       480
     gcggtgttcg ggctggaggt cgtggtggtg gggcgcatgg gctacgaggc cctgctgccc       540
     gcgctggtgg catccgtggt gggagacatg gtgacgcggg ggctgggcat ccaccacacg       600
     ccgtatccgg cgccgggggc gctgccgctg acagtggcgg tgctggcgaa gtggctggtg       660
     ttcgcggtgg cggtggccgt ggtggcggtg gtgttcgtgg agttgatgca ccggctgaag       720
     aagctgctgg agcagcgcgt gcaggtgttg ccgctgcgga tggcgttggg cggtctggcc       780
     gtgctgctgc tgtggctgct ggccggtacg gatgactacc tgggcctggg ggtaccgggc       840
     atccagcgag ccttcgagga cccggcgctg cccgtgtcgg cgttcgcgtg gaagcttgcc       900
     ttcacggtgg tgacgctggc cgcgggattc ctgggcggcg aggtgacgcc gctgttcttc       960
     atcggcgcat cgctgggcaa cgtcctggcg cggctgttgg gcctgccgtt ggatttgggc      1020
     gcggcggtgg gcatggcggc cctgttcgcg gcggcggcga atacgccgct ggcgctgtcc      1080
     atcatggccg tggagctgtt gggggcgaat gtgttgcccc acgtggcgat tgtggccacg      1140
     gtggcgtacc tgctcacggg gcaacggggc atctatccat cacagcggat tgcccggatg      1200
     aaacacggag ggccgctgct ggagaaactc gtggccctgc gggagctggc ccgcgaggac      1260
     cgcgccccgc cctcagggcc tgagggacgg ggcggcggct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page