(data stored in ACNUC30630 zone)

EMBL: CP000113.PE13

CP000113.PE13        Location/Qualifiers
FT   CDS_pept        complement(16412..18307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0016"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="identified by match to protein family HMM TIGR01840"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86069"
FT                   /db_xref="GOA:Q1DGC4"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC4"
FT                   /protein_id="ABF86069.1"
FT                   /translation="MLKQRRSRSWPWSWSAGVPLAAWLFAGLAGCGAPVGDAPEVEPEV
FT                   TEQQQPLLTQVTSFGSNPGNLQMFRHVPSGMPANAPLVVVMHGCTQRAAGMEGAGWSAA
FT                   ADVYKFYVVYPQQQGGNNMTSCFNWFEPGDFSRDRGEALSIKQMVDTMKATYSIDPSRV
FT                   FVAGFSAGGYMTPALLAAYPDVFSAGAIHSGGPYRCAESMNAGFSCMSPGVNRTPAAWG
FT                   DVVRSAYPGYAGPRPRVTIWHGTSDYTVNVMNLTEAMEQWTNVHGIDQTPDTVETVSGF
FT                   PHKVYRDGAGNALVETWELTGMGHAVAMDAQFPFPGGTGSAACGSVGAYLSDVNLCSVY
FT                   HQVKFFGMTGGGGEPTGDTTPPTVNVTAPASGATVSGTVNVTADAADAVGVTRVEFLVN
FT                   GEVVSTDTQAPYAFAWNSTAVSNGQYTLGARAFDAAGNQATDNDTVVTVSNSGSPAPVT
FT                   VQFASIAADDGYLKADADGSGAALGFMTNLALGRGTDGKYNRSFLSFDTSSLPDGATVT
FT                   RAFLTVSYSSGSGDPWSTPAGNTLVIDAKTGTFNAANTEVTDWAAAATASSVAGIDRFS
FT                   AGTKSSGDFSADGLSAISKTGKTQLRLRFTQAQTATQYLFIRDGANAVLTVAYTP"
     atgctcaagc agcgtcgcag ccgttcctgg ccgtggtcgt ggtccgccgg ggtgcctctt        60
     gccgcgtggc tgttcgcggg cctcgcgggc tgtggcgctc ccgtcgggga cgcgccggag       120
     gtggagcccg aggtgacgga gcagcagcag cccctgctga cgcaggtgac aagcttcggt       180
     agcaaccccg gcaacctgca gatgttccgc cacgtaccgt ccggcatgcc ggccaacgct       240
     ccgctggtgg tggtgatgca cgggtgtacg cagcgggccg cggggatgga gggcgccggc       300
     tggtccgcgg cggcggacgt ctacaagttc tacgtcgtct atccgcagca gcagggtggc       360
     aacaacatga ccagttgctt caactggttc gagcccggtg acttctcacg agaccggggc       420
     gaggcgctgt ccatcaagca gatggtggac acgatgaagg ccacgtactc catcgacccg       480
     tcacgggtgt tcgtggcggg gttctcggcg gggggataca tgacgcccgc gttgctggcc       540
     gcctatccgg atgtcttctc cgccggggcc atccactccg gtggccccta ccggtgcgcg       600
     gagtcgatga atgcgggctt cagttgcatg agcccgggtg tgaatcgcac gcccgccgcg       660
     tggggagacg tggtccgcag cgcgtacccg ggctacgcgg gtccgcgtcc gcgcgtcacc       720
     atctggcacg gcaccagtga ctacacggtg aacgtgatga acctcaccga ggcgatggag       780
     cagtggacga acgtgcacgg catcgaccag acaccggaca cggtggagac ggtgtccggc       840
     ttcccgcaca aggtgtaccg ggacggcgca ggcaacgcgc tggtggagac gtgggaactc       900
     accggcatgg gccacgcggt ggccatggat gcgcagttcc cgtttccagg cggcacgggc       960
     agcgcggcct gtggctcggt gggggcgtac ctgagcgatg tgaatctctg ctccgtctac      1020
     caccaggtga agttcttcgg gatgacggga ggcggaggtg agcccacggg ggataccacg      1080
     ccgcccaccg tcaacgtgac ggcgccggcg agcggggcca cggtgagtgg cacggtgaat      1140
     gtcaccgcgg atgcggcgga cgcggtgggc gtcacccggg tggagttcct ggtgaatggc      1200
     gaggtggtgt ccacggacac gcaggcgccg tatgccttcg cttggaacag cacggccgtg      1260
     tccaacgggc agtacacgct gggggcccgt gcgtttgacg ccgcgggcaa tcaggcgacg      1320
     gacaacgaca cggtggtgac ggtgagcaac tcaggctccc cggcgccggt gacggtgcag      1380
     ttcgccagca tcgcggcgga tgatggctac ctgaaggcgg acgcggatgg cagcggggcg      1440
     gcgctgggat tcatgacgaa cctggcgctc ggccggggga cggatgggaa gtacaaccgg      1500
     tcgttcctct ccttcgacac gtcgagcctt ccggacgggg ccaccgtcac gcgggcgttc      1560
     ctgacggtga gctactcgtc gggctcggga gacccgtggt cgacgcccgc ggggaacacg      1620
     ctggtcatcg acgcgaagac ggggacgttc aacgcggcga acacggaggt gacggactgg      1680
     gcggcggcgg ccacggcgag cagcgtcgcg ggcatcgacc ggttcagcgc gggaacgaag      1740
     agctccgggg acttcagcgc ggatggactc tccgccatca gcaagacggg gaagacgcag      1800
     ctccggctgc gcttcaccca ggcgcagacg gccacgcagt acctgttcat ccgggatggg      1860
     gcgaacgcgg tgctgacagt cgcctatacg ccgtag                                1896
//

If you have problems or comments...

PBIL Back to PBIL home page