(data stored in ACNUC30630 zone)

EMBL: CP000113.PE136

CP000113.PE136       Location/Qualifiers
FT   CDS_pept        162330..163220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8ZN39"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90905"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG01"
FT                   /protein_id="ABF90905.1"
FT                   /translation="MKWRWLLGGALALGLLAALAVFGRALRHSEAYFHYPRPKAERPAD
FT                   FAEAKDVSLQTSDGLTLRGWYVPSRNRAAVVLAHGLSQTRADLLPEARILRAAGYGVLL
FT                   FDLRAHGESEGGFSTWGDLERRDVRAALDFVRAQPDVDPERVGALGFSIGSAAVAEVAA
FT                   EDPAVRAVVLLSPFNTLWLAAAYDFRRFGFVSQSGALVPFWRRGIALEEVRTIDAVERI
FT                   RPRPLLIVMGTEESGQPLADELFAKVREYAQTWRIQGAGHGNFSATEPEAYPRRLTDFL
FT                   NAALLARGTSATDAR"
     atgaagtggc ggtggctgct gggtggagcg ctcgcgctgg ggctgctggc cgcgctggcg        60
     gtgttcggta gggcgctgcg tcattccgag gcctacttcc actacccacg tcccaaggcc       120
     gagcgccccg ctgatttcgc cgaggcaaag gacgtttcgc ttcagacgtc ggatgggctg       180
     acgctgcggg gctggtacgt gccgtcccgc aaccgcgccg ccgtggtgct ggcgcacggc       240
     ctgtcccaga cgcgcgcgga cctgctgccc gaagcgcgaa tcctgcgggc cgcgggctat       300
     ggcgtgctgc tcttcgacct gcgcgcccac ggtgaaagcg agggtggttt ctccacctgg       360
     ggagacctgg agcgccggga cgtgcgggcc gcgctggact tcgtgcgcgc ccagccggac       420
     gtggacccgg agcgggtagg ggcgctcggc ttctcgattg gctccgcggc cgtggcggag       480
     gtggcggcgg aggacccggc ggtgcgcgcg gtggtgctgc tgtccccgtt caacacgctg       540
     tggctggccg ccgcgtatga cttccgccgc tttggcttcg tgtcgcagtc cggggcgctg       600
     gtgcccttct ggcggcgcgg catcgccctg gaagaggtgc gcaccatcga cgcggtggag       660
     cgcatccgcc cccggccgct gctcatcgtc atggggacgg aggagtcagg acagccgctc       720
     gccgacgagc tcttcgccaa ggtgcgcgag tatgcccaga catggcgcat ccagggcgcc       780
     gggcacggga acttcagcgc caccgagcca gaggcgtacc cgcgccggct gacggacttc       840
     ctcaatgccg cgttgctggc gcgcggcacc tcggcgacgg acgcgcgctg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page