(data stored in ACNUC30630 zone)

EMBL: CP000113.PE138

CP000113.PE138       Location/Qualifiers
FT   CDS_pept        complement(165082..166935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0141"
FT                   /product="SWIM zinc finger domain protein"
FT                   /note="identified by match to protein family HMM PF04434"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86122"
FT                   /db_xref="GOA:Q1DFZ9"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ9"
FT                   /protein_id="ABF86122.1"
FT                   /translation="MTTATRHPVELRYATASDVESGADDSRVRLALEGSRGTVGVSGRV
FT                   TDAALFRDALAATFGILASDLRYRGKDRTAYLAYLMKQGKRASALIWEAQKAFLDNALD
FT                   GEKKQDAVLDPVLTVDPDSVSLEVFSRDESAYARLSFDNRLFEGREAAHGSTFLDVPPE
FT                   LPARVDRLRTYVPVSLEAHVALATPASQPPRAPRNVEVPHAWLRGFLQVQSAATLPAST
FT                   CELAPIDLYNLLFALRARKAKKAPRALRFELVPGAPPRLVLEPWELVLECHGGTYNGTA
FT                   PAVVRTFGRQRLAALARLLPHAKSVRVQLMGPGLPVFWVIDMGAATLTLGLTGWTESGW
FT                   SSAAAFDVLMPRAVPDGLAEQLRNRLRTEGPLPFDTLAANAGAPKESVRAALQLECLRG
FT                   RILFDVARGQYRPRELMPTPVDAAVIRYGNELEARAHRLLGGDGAPGAGEVKLTKVHDV
FT                   VGEGIRIHGEVVDREALRSFFPSFTLDLEGRVKDASCGCPHHRRSGLREGPCEHLLALR
FT                   LAYARRRAEEEALRQTPEGRKLIRAETRSYVRRDAESGLETVYRVSLDGQVVAVEWGPR
FT                   TGSPRHQRLWFDSDAEARGAYFARLEKLAADGYIDAASALV"
     gtgacgaccg ccacccgaca ccccgtcgag ctgcgctacg ccaccgcgag cgacgtcgag        60
     tccggcgcgg acgactcccg cgtccgcctg gccctggagg gctcgcgcgg caccgtgggc       120
     gtgagcggcc gcgtcaccga cgccgccctc ttccgcgacg cgctggccgc caccttcggc       180
     atcctcgcca gcgacttgcg ctaccggggc aaggaccgca ccgcgtacct cgcctacctg       240
     atgaagcagg gcaagcgggc aagcgcgctc atctgggagg cgcagaaggc gttcctggac       300
     aacgcgctgg acggcgagaa gaagcaggac gcggtgctgg accccgtgct cacggtggat       360
     ccagacagcg tgtccctgga ggtcttctcc cgcgacgaga gcgcctacgc ccggctgtcc       420
     ttcgacaacc gcctcttcga gggccgcgag gccgcgcacg gctccacctt cctggacgtg       480
     ccgccggagc tgcccgcccg cgtggaccgg ctgcgcacct acgtgcccgt ctccctggag       540
     gcgcacgtcg cgctggccac gccggcctcg cagccgcccc gcgccccgcg caacgtggag       600
     gtgccccacg cctggctgcg cggcttcctc caggtgcagt ccgccgccac gctgcccgcg       660
     agcacctgcg agctggcgcc catcgacctc tacaacctcc tcttcgccct gcgcgctcgc       720
     aaggcgaaga aggccccccg cgcgctgcgc ttcgagctgg tgcccggcgc cccgccccgg       780
     ctggtgctgg agccgtggga gctggtgctg gagtgccacg gcggcacgta caacggcacc       840
     gcgcccgcgg tggtgcgcac cttcggccgt cagcgcctgg ccgcgctcgc gcgcctgctg       900
     ccccacgcga agtcggtgcg ggtgcagctc atgggccccg gcctgccggt gttctgggtc       960
     atcgacatgg gcgcggccac gctcacgctg ggcctcacgg gctggacgga gagcggctgg      1020
     tcctccgccg cggccttcga cgtgctgatg ccccgcgcgg tgccggacgg attggcggag      1080
     cagcttcgca accgactgcg gaccgaaggt cccctgccct tcgacacgct cgccgccaat      1140
     gccggcgcgc ccaaggagtc cgtgcgcgcg gcgctccaac tggagtgcct gcgcggacgc      1200
     atcctcttcg acgtggcgcg cggccagtac cgtccgcgcg agctgatgcc cacgccggtg      1260
     gacgccgccg tcatccgcta cggcaacgag ctggaagcac gggcgcaccg cctgctgggc      1320
     ggcgacggcg ctccgggcgc gggcgaggtg aagctgacca aggtgcacga cgtggtggga      1380
     gagggcatcc gcatccacgg cgaggtggtg gaccgcgagg ccctgcgcag cttcttcccc      1440
     agcttcacgt tggatttgga aggccgcgtg aaggacgcca gctgcgggtg tccgcaccac      1500
     cggcgctccg gcctgaggga aggcccctgc gagcacctgc tggcgttgcg gctggcctac      1560
     gcgcgccgcc gcgcggagga agaggcgctg cggcagacgc ccgagggccg caagctcatc      1620
     cgcgcggaga cgcgctccta cgtgcggcgc gacgcggaga gcggcctgga gacggtgtac      1680
     cgggtttccc tggatggtca ggtggtggcg gtggagtggg gcccgcgcac gggctcgccg      1740
     cgtcaccagc ggctctggtt cgactcggat gcggaagcgc gcggagcgta cttcgcgcgc      1800
     ctggagaagt tggcggctga cggctacatc gacgcggcct cggcattggt gtaa            1854
//

If you have problems or comments...

PBIL Back to PBIL home page