(data stored in ACNUC30630 zone)

EMBL: CP000113.PE15

CP000113.PE15        Location/Qualifiers
FT   CDS_pept        complement(19574..21286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0018"
FT                   /product="serine/threonine kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P54738; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90490"
FT                   /db_xref="GOA:Q1DGC2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC2"
FT                   /protein_id="ABF90490.1"
FT                   /translation="MCPDSGVPAEGFPIDFYRGERIGKYEVVTQLSVGGMAELFLGFTS
FT                   GPGGFRKYVVIKRVLPDARDNAQFERMFLDEARITAAFNHPNIAQVFDLGREDDGLYLA
FT                   MEFIAGQNLNQITGACLRRQEQLPLGFTLSVARDVCMALHYAHTYTAPSGAPSPVIHRD
FT                   VAQKNIMVTYDGVVKLLDFGIAKAKDSLERTNVGTVKGTTGYMSPEQVRGDTLDGRSDL
FT                   FSVGVMMHELITGARLFAGKNERDEMMKILEAPVPWPSHVAPHVPEEVSKVVMRALERS
FT                   REKRFANGRDMARAIEAAAGKLLLDAHDRAALMQDWFAERMSATRVMLESADGTTNGVM
FT                   LDSAKRALRSDDGPYLPERKDIPTPSNGVAGMPRKPSRKVPAAAAPRKASAAVEGTPQP
FT                   PESKASNVLWGLVLMGILVGGGYAAWHLSKVLNETVDEKDASALRTLPQHDPNLPVYLG
FT                   PGSGPPTDAGNTETPAKVSGGEDAEGSRSKEAASARPVKGRGKLTLLVLPEAEVFRGKK
FT                   RVGRTPMFNVAMPAGEHDLTIVGPDGKKRMLSVPISAGETTQFRLKLAEIPER"
     atgtgccccg acagcggggt gccggcggag ggtttcccca tcgacttcta tcggggcgag        60
     cgcatcggga agtacgaggt cgtcacgcag ctctccgtgg gcggaatggc ggagctgttc       120
     ctgggcttca cttcgggtcc gggtggcttc cgcaagtacg tggtcatcaa gcgggtgctg       180
     ccggacgcgc gggacaatgc gcagttcgaa cgcatgttcc tggacgaggc gcgcatcacc       240
     gcggccttca accacccgaa catcgcgcag gtgttcgacc tggggcgcga ggatgacggg       300
     ctctacctgg ccatggagtt catcgccggg cagaacctga accagattac cggcgcgtgc       360
     ctgcgccgcc aggagcagct cccgctgggc ttcacgctgt cggtggcgcg cgacgtctgc       420
     atggcgctgc actacgcgca cacctatacg gcgccctccg gcgcgcccag ccccgtcatc       480
     caccgcgacg tcgcccagaa gaacatcatg gtgacgtacg acggcgtggt gaagctgctc       540
     gacttcggca tcgccaaggc gaaggacagc ttggagcgca ccaacgtcgg cacggtgaag       600
     ggcaccaccg ggtacatgtc cccggagcag gtgcggggcg atacactgga tggccgcagt       660
     gacttgttct ccgtcggggt gatgatgcac gagctcatca ccggcgcgcg cctgttcgcg       720
     ggcaagaatg agcgcgacga gatgatgaag atcctggagg cgcccgtccc ctggccctcg       780
     cacgtcgcgc cgcacgtgcc cgaagaggtg tccaaggtgg tgatgcgggc gctggagcgc       840
     agccgcgaga agcgcttcgc caacggccgg gacatggccc gggcgattga agcggcggcg       900
     ggcaagttgc tgctggacgc gcatgaccgg gccgcgctga tgcaggactg gttcgccgag       960
     cgcatgtccg ccacgcgcgt catgctggag tccgcggacg gcaccaccaa cggcgtcatg      1020
     ctggactccg cgaagcgggc cctgcgcagt gatgacggac cctacctccc cgagcgcaag      1080
     gacatcccga cgccgtcgaa cggcgtggcc ggcatgccgc gcaagccctc gcgcaaggtg      1140
     cccgctgctg cggcgccccg gaaggcttcg gcggccgtgg agggcacgcc gcagccgccg      1200
     gagagcaagg cctccaatgt gctgtggggg ctggtgctga tgggcatcct ggtgggcggt      1260
     ggctatgccg cctggcacct gtcgaaggtg ctgaacgaga cggtggatga aaaggacgcg      1320
     agcgcgctgc gcaccctccc ccaacacgac ccgaacctgc ccgtctacct gggaccaggc      1380
     tcgggcccgc ccacggatgc cggcaacacg gagactccag cgaaggtgtc gggcggcgag      1440
     gacgcggagg gctcccgttc caaggaggcg gcgagcgccc gtccggtgaa gggccggggc      1500
     aagctgacct tgctggtgct gccggaggcg gaggtcttcc gaggcaagaa gcgggtgggc      1560
     cgcacgccga tgttcaacgt ggcgatgccc gcgggggagc acgacctgac catcgtgggc      1620
     ccggacggca agaagcgcat gctgtcggtg ccgatcagcg ccggggagac gacccagttc      1680
     cggctgaagc tggcggaaat ccccgagcgc tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page