(data stored in ACNUC30630 zone)

EMBL: CP000113.PE155

CP000113.PE155       Location/Qualifiers
FT   CDS_pept        193489..194274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0158"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87570"
FT                   /db_xref="GOA:Q1DFY2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY2"
FT                   /protein_id="ABF87570.1"
FT                   /translation="MPTTSAKDGTSLHYRVVGEGPRTVILVHGWMVSGAVWDALVERLD
FT                   LTGLRLVIPDMRGSGQSGRPDGGFSLESLAHDVLAVADAVDARRFTLVGHSMGGQLVKW
FT                   VAAEVPARVEGLVLLNTVPAAGLPLPPDAAGLFRTSADSREKKQTILGLACKQLSPEAL
FT                   EALVKDSMGVSPAAIEHVFDAWTAGGFADKLASITAPTLVLATDDAFLPAAFLREAVVS
FT                   RIRGARLSYLPGPGHYPQVERPAETAALVSAFLAGSQPA"
     atgcccacga cttcagcgaa agacgggact tcgctccact accgtgtcgt gggtgagggt        60
     ccgcgcacgg tcatcctggt ccacggttgg atggtatcag gcgcggtctg ggatgcgctg       120
     gtggagcgcc tggacctgac ggggctgcgg ctggtgattc cggacatgcg gggctcgggt       180
     cagtcgggcc ggccggacgg aggcttcagt ctggagtcgc tggcgcacga cgtgctggcc       240
     gtggcggacg ccgtggacgc gcggcgcttc acgctggtgg ggcacagcat gggcggccag       300
     ctggtgaagt gggtggccgc ggaagtgccg gcgcgcgtgg aggggctggt gctcctcaac       360
     acggtgcccg ccgcgggtct tccgctgcct ccggatgcgg cggggctgtt ccgcacgtcg       420
     gcggacagcc gcgagaagaa gcagaccatc ctcggactcg cgtgcaagca gttgtcgccg       480
     gaggccctgg aggcgttggt gaaggactcg atgggcgtca gcccggcggc catcgagcac       540
     gtcttcgacg cgtggacggc gggtggcttc gccgacaagc tggcctcgat tacggcgccc       600
     acgctggtgt tggccacgga cgacgccttc ctgccggcgg ccttcctgcg ggaggcggtg       660
     gtgtcgagga ttcgcggcgc gcgcctgtcg taccttcccg gccccggtca ttacccacag       720
     gtggagcgcc cggcggagac ggcggcgctg gtgtccgcct tcctcgccgg ctcccagccg       780
     gcctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page