(data stored in ACNUC30630 zone)

EMBL: CP000113.PE158

CP000113.PE158       Location/Qualifiers
FT   CDS_pept        complement(195530..196189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO57075.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86553"
FT                   /db_xref="GOA:Q1DFX9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX9"
FT                   /protein_id="ABF86553.1"
FT                   /translation="MQAPERRRPQPWLIRVTHWLNVPLLLIMAASGLQILVAYPMLGPQ
FT                   GRPYGWYPYQGIPPPEWMRLGNWLAGARHWHFAFAWFLILNGVAYVLYLALSGEWRRRL
FT                   FLPRRDTRNALDTLAFYLRVRKHAPAQGLYNGLQRLAYTGTLALGLLAVLSGLVLYKPV
FT                   QFGALTSLLGGYDAARAIHLVILALLALFTVGHITLVLLHPRSLAEMVTGGRKPDA"
     gtgcaagccc ctgaacgacg caggcctcag ccgtggctca tccgagtcac ccactggctc        60
     aacgtaccgc tgctgctcat catggcggcc agcggactcc agatacttgt cgcctatccc       120
     atgctcggac cacagggccg gccctacggc tggtatccct accagggcat ccctccaccc       180
     gaatggatgc ggctggggaa ctggctggcc ggcgcccgtc actggcactt cgccttcgcg       240
     tggttcctca tcctcaacgg cgtggcgtac gtgctctacc tcgccctcag cggtgagtgg       300
     cgccgccgcc tcttcctgcc ccgccgcgac acacgcaacg ccctggacac gctcgccttc       360
     tacctgcgcg tgcgaaaaca cgcgcccgcg caggggctct acaacggcct tcagcggctg       420
     gcgtacacgg gcacgctggc gctgggactg ctcgcggtgc tctccgggct ggtcctctac       480
     aagcccgtgc agttcggcgc gctcacttcg ctgctaggtg gctacgacgc ggcgcgcgcc       540
     atccacctcg tcatcctggc gctgctcgcc ctgttcaccg tgggccacat caccctggtg       600
     ctgctccacc cgcgaagcct ggcggagatg gtgacgggcg gaaggaagcc ggatgcctag       660
//

If you have problems or comments...

PBIL Back to PBIL home page