(data stored in ACNUC30630 zone)

EMBL: CP000113.PE177

CP000113.PE177       Location/Qualifiers
FT   CDS_pept        complement(217450..218832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0180"
FT                   /product="sigma-54 dependent transcriptional regulator, Fis
FT                   family"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88905"
FT                   /db_xref="GOA:Q1DFW0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW0"
FT                   /protein_id="ABF88905.1"
FT                   /translation="MAAEEVRPATPLLGIHDAGPCVRRREPGYAPAMPTSHLALPALDA
FT                   LAGPVLLVDDARKVTALTPALEALLGGTLRAGTPLAQVLGRADGTEPLDAVLKNGCEAS
FT                   VRLRVGGRSKPVRVRAVPLARGPRASGWALLVSPDAVEETNGRAELFHGLWTQAPELQR
FT                   VFRIVEKVARTESSVLVRGESGTGKEHIAHALHALSARARGPFRAINCAALPPNLLESE
FT                   LFGHVRGAFTGAVRDSPGHFRLADKGSLFLDEVAEMPLDLQAKMLRVLETRTVIPVGGR
FT                   QPVPVDVRIIAATHRPLRREVETGRFRADLMYRLRVVPLFLPTLRERRGDILPLALRFL
FT                   EELHQRGARRVERFSPGARRLLEEHPWPGNVRELRNVMEYAYVIGEGPVVREADLPPEF
FT                   SEQRQAAPAKLPPPDASLEPERIRAALAQAGGNRSEAARLLGVSRVTLWRRLRDLGATA
FT                   ER"
     gtggctgctg aagaagtacg gcctgccacg cctctactgg gcattcatga tgcggggcct        60
     tgcgtaagac gccgggagcc gggctatgca ccggcgatgc ccacctccca cctcgcgctc       120
     cccgctctgg atgccctcgc gggccccgtg ctcctcgtgg acgacgcgcg gaaggtgacc       180
     gcgctcacgc ccgcgctcga agccctgctg ggcggcacgc tgcgcgctgg gacaccgctg       240
     gcgcaggtcc tggggcgcgc tgacggcacg gagccgctgg acgccgtcct gaagaacggg       300
     tgtgaggcct ctgtccgctt gcgcgtgggt gggcgctcga agcccgtgcg ggtgcgcgcc       360
     gtccccctgg cgcgagggcc tcgggcatcc gggtgggccc tgctcgtctc gcctgacgcg       420
     gtggaagaga cgaacggtcg cgcggagctg ttccacggcc tgtggaccca ggcgcccgag       480
     ttgcagcgcg tcttccgcat cgtcgagaag gtggcccgca ccgagtccag cgtgctcgtt       540
     cgcggggagt cgggcaccgg caaggagcac atcgctcacg cgctgcatgc gctgtcggca       600
     cgggcgcgag ggccgtttcg cgccatcaac tgcgcggcgc tgccgcccaa cctgctggag       660
     agcgagctgt tcggccatgt gcgcggcgcc ttcacgggcg cggtgcgcga cagcccagga       720
     catttccggc tcgcggacaa gggctcgctg ttcctggacg aggtggcgga gatgcccctg       780
     gacctccagg cgaagatgct gcgcgtgctg gagacgcgca ccgtcatccc cgtgggaggc       840
     cgccagcccg tgcccgtgga cgtgcgcatc atcgccgcca cgcaccggcc gcttcggcgc       900
     gaagtggaga cggggcgctt ccgcgcggac ttgatgtacc gcctgcgcgt ggtgccgctc       960
     ttcctcccca cgctgcggga gcgacgaggc gacatcctcc cactggccct gcggttcctg      1020
     gaggaactgc accagcgagg cgcccgccgc gtggagcgct tctctcctgg cgcccgccgc      1080
     ttgctggagg agcacccctg gcccggcaac gtgcgcgaac tgcgcaacgt gatggagtac      1140
     gcctacgtca ttggcgaagg cccggtggtt cgagaggcgg acctgccacc ggagttctcc      1200
     gagcagcggc aggccgctcc cgcgaagctg ccgcctccgg atgcctcgct ggagccggaa      1260
     cggatccgcg ccgcgctcgc ccaggcgggc ggcaaccgct ccgaggccgc gcgcctgctc      1320
     ggcgtcagcc gcgtgacgct gtggcggcgc ctgcgcgacc tgggtgcgac ggcggagcgc      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page