(data stored in ACNUC30630 zone)

EMBL: CP000113.PE189

CP000113.PE189       Location/Qualifiers
FT   CDS_pept        complement(233826..234929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89338"
FT                   /db_xref="GOA:Q1DFU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU8"
FT                   /protein_id="ABF89338.1"
FT                   /translation="MALSVQYFHREEFETRTLRALGGAACMGLVAGAVPDLHLTPEYLA
FT                   IVAAAQACVKPTGVHPLALRLALTVLPALPYFFRAPEPLPVSLAGALAAAMVAWLGHGR
FT                   EQPGQPAAVATSAAAAGLLVPLGLYVQQVLEARFLGSDGLLSALVGFLVVGLFWSIGTL
FT                   PANLRVELDAVEARGRQLQDALKGDSHTLATRALALYRQCKDVVTKMPPSTGRTELLGV
FT                   LEKMTGDSFSLAEVHFGLEAQLGSVVANDVDAQVRELRERAAATQDAVARRQLELAASS
FT                   LGEELNHLDVLARRKERLLAQLHAQVALLERARVSFIGVQGNELGAKGAQAADLARKLK
FT                   QLGEPSSSGGPDDVASVAAPNPTRVAP"
     atggccctct ccgtgcagta cttccaccgc gaggagttcg agacccgcac gcttcgcgcg        60
     ctgggaggtg ccgcctgcat gggcctggtc gcgggggccg ttccggacct gcacctgaca       120
     ccggagtacc tcgccatcgt ggccgcggcg caggcgtgcg tgaagcccac cggggtccac       180
     cccctggcgc tgcgcctggc gctgacggtg ctgcccgccc tgccctactt cttccgggcc       240
     ccggagccgt tgcccgtgag cctcgcgggc gcgctcgccg cggcgatggt ggcctggctg       300
     ggccatggac gggagcagcc gggacaaccc gccgcggtgg ccaccagcgc cgccgccgcg       360
     ggcctgctcg tcccactggg cctctacgtc caacaggtgc tggaggcgcg cttcctgggg       420
     agcgacggcc tgctgtcggc gctggtgggc ttcctcgtcg tgggcctctt ctggagcatc       480
     ggcacgctgc cggccaacct ccgcgtggag ctggacgcgg tggaggcgag gggccgccag       540
     ttacaggacg cgctcaaggg cgactcgcac accctggcca cgcgggccct ggccctctac       600
     cgccagtgca aggacgtggt gacgaagatg ccgcccagca ccgggcgcac ggagctgctg       660
     ggcgtgctgg agaagatgac gggcgacagc ttctcactgg cggaggtcca cttcgggctg       720
     gaggcgcagc tcggctccgt ggtggccaac gacgtggacg cccaggtgcg cgagctgcga       780
     gagcgcgccg ccgccacgca ggacgcggtg gcccgccggc agttggagct ggccgcgtcc       840
     tctctgggtg aagagctcaa ccacctggac gtgctggccc gccgcaagga gcggctgctg       900
     gcccagctcc acgcgcaggt ggcgctgctg gagcgcgccc gggtctcctt catcggagtg       960
     cagggcaacg agctgggtgc caagggcgcg caggccgctg acctggcgcg caagctgaag      1020
     caactgggag agccctcctc cagcgggggg cccgacgacg tcgcctccgt ggccgcgccg      1080
     aaccccacgc gcgtcgcccc ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page