(data stored in ACNUC30630 zone)

EMBL: CP000113.PE199

CP000113.PE199       Location/Qualifiers
FT   CDS_pept        248324..249289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0203"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88408"
FT                   /db_xref="GOA:Q1DFT8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT8"
FT                   /protein_id="ABF88408.1"
FT                   /translation="MDRSAREGLAQAVREHERFLWGLCYRMTGVSADAEDLVQETFVRA
FT                   LASPPARTEALRPWLTRVAVNLARDTLRRRKREGYVGPWLPSPLDTGEEELPPPGVEAR
FT                   LPGGGSTEGRYALLESVSFAFLLALEVLSPKQRAVLLLRDVFDYSVREVAEALNLRESN
FT                   VKVVHHRARAAMAAYDRARCLPTREFQARARAALEGFLGALLTGDVAAAEALLASDVCA
FT                   LSDGGGQYRAARVPVLGQSRVLLLYRRLMEMRGAPSAVELRMLNGLPAVVAVFPPPQRD
FT                   PQAGTQMVVRVELGADGRITQVHSILTDRKLAGLRMPVPA"
     atggaccgct ccgcgcgcga aggactggcg caggccgtgc gcgagcacga gcgcttcctg        60
     tgggggctct gctaccgcat gacgggcgtg tcggcggacg cggaggacct ggtgcaggag       120
     accttcgtgc gcgccctggc ctcgccgccc gcgcgaacgg aggcgctgcg cccctggctg       180
     acgcgggtgg cggtgaacct ggcccgggac acgttgcggc ggcgcaagcg cgagggctac       240
     gtgggcccct ggctgccctc gccgctggac acgggagagg aggagctgcc gccccctggc       300
     gtggaggcgc ggctgccggg aggcggctcc acggagggtc gctacgcgct gctggagagt       360
     gtctccttcg ccttcctgct cgcgctggag gtgctgtctc ccaagcagcg ggcggtgctg       420
     ctcctgcgcg acgtgttcga ctactcggtg cgcgaggtgg ccgaggcgct gaacctgcgc       480
     gagtccaacg tgaaggtggt gcaccaccgc gcgcgggcgg cgatggcggc gtacgaccgc       540
     gcccgctgcc tgccgacgcg ggagttccaa gcgcgcgccc gcgccgcgct ggagggcttc       600
     ctgggtgcgc tgctgacggg ggacgtggcg gcggcggagg cgctgctcgc cagcgacgtg       660
     tgcgcgctgt cggacggcgg tggccagtac cgcgccgcgc gcgtgccggt gctgggacag       720
     tcgcgcgtgc tgctgctcta ccggcggctg atggagatgc ggggggcgcc ctccgccgtg       780
     gagctgcgga tgctcaacgg cctgccggcg gtggtggccg tgtttcctcc gccccagcgc       840
     gacccgcagg cgggcaccca gatggtggtc cgcgtggagc tgggggcgga cgggcgaatc       900
     acacaggtcc actccatcct cacggaccgc aagctcgccg ggctgcgcat gcccgtgccc       960
     gcctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page