(data stored in ACNUC30630 zone)

EMBL: CP000113.PE202

CP000113.PE202       Location/Qualifiers
FT   CDS_pept        251454..252881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0206"
FT                   /product="peptidase, S8A (subtilisin) subfamily"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89812"
FT                   /db_xref="GOA:Q1DFT5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT5"
FT                   /protein_id="ABF89812.1"
FT                   /translation="MKSYLLVPKESIETQARVGPRGTEQGERVLSRTTALRFAVANKAP
FT                   DALFALGLRSATLPGARPPVSGQEERRRKGKGAKSARTGTRGADSSTPPMPGATVAEQT
FT                   GAEPGSYRYMPLIGATMAHFYEDHTEKEARGELERDFEFIPDVVPLSFPGPVSAGQPGP
FT                   RNRGMSSLAEREWPDECGVPLAHAQGIRGAGVMLGILDTGVDADHPEHAARVIQFRYVS
FT                   LFPNSPHNPARDIRGFDPDGHGTHVCGIAAGVHHGVAPEVDLYVASVIESETIRTSLGR
FT                   VAAGMEWLLHQFSRPENSTRPAVVNLSLGFPLMPPPGISEADYNLNLRALQTMIRRLLD
FT                   SNVLPVVAAGNSGPDTVGYPAAFPESLAVGAVDFERNVATFSASGTVGRRVVPDIMGYG
FT                   VNVYSSTERRCNNQAFYERMSGTSMAAPYVAGIAALYRCRAPDLTALEVRDLILSNAVK
FT                   LPRSGTHKTGKGLAVFR"
     atgaagtcct acctgttggt tccaaaggag tccatcgaga cgcaggctcg tgtggggcct        60
     cgcggcacgg agcagggcga gcgcgtgctg tcgcgcacga cggcgctgcg cttcgcggtg       120
     gcgaacaagg cgcccgacgc gttgttcgct ctcggactgc ggtcggccac gctgcccggc       180
     gcgcgtccgc ccgtcagtgg acaggaagag cgccgtcgga agggcaaggg cgcgaagtcg       240
     gcgcgcacgg gcacgcgcgg cgcggactcc tccacgccgc ccatgccggg cgcgacggtg       300
     gccgagcaga ccggcgcgga gcccggcagc taccggtaca tgccgctcat cggtgccacc       360
     atggctcact tctacgaaga ccatacggag aaggaagccc gcggcgagct ggaacgcgac       420
     ttcgagttca tccccgacgt cgtcccgttg tccttccccg gcccggtgtc ggctggacaa       480
     cccggaccgc gcaaccgggg catgtcctcg ctggccgagc gcgagtggcc cgacgagtgc       540
     ggcgttcccc tggcccacgc ccagggcatc cgcggcgccg gcgtcatgct gggcatcctc       600
     gacaccggtg tggacgcgga ccaccccgag cacgcggcgc gcgtcatcca gttccgctac       660
     gtgtcgctgt tccccaactc gccgcacaat ccggcgcgtg acatccgcgg cttcgacccg       720
     gacggccacg gtacgcacgt gtgcggcatt gccgcgggtg tgcaccacgg cgtcgccccg       780
     gaggtggacc tctacgtcgc gtccgttatc gaatcggaga ccatccgcac cagcctgggc       840
     cgcgtggccg cgggcatgga gtggctgctg caccagttca gccgcccgga gaactcgacg       900
     cggcccgcgg tggtcaacct gtcgctcggc ttcccgctga tgccgccgcc cggcatctcg       960
     gaggcggact acaacctcaa cctgcgcgcg ctgcagacga tgattcgtcg cctgctcgac      1020
     agcaatgtcc tgccggttgt ggcggcaggt aacagtggac ccgacacggt tggttatcca      1080
     gccgcctttc cagagtcact ggctgtcggc gcggtcgact tcgagcgtaa cgtggccaca      1140
     ttctccgcga gtggcaccgt gggtaggcgc gtcgtgccgg acatcatggg gtatggggtg      1200
     aatgtctatt ccagcacgga gcgtcgttgt aacaaccagg cgttctacga gcgaatgagt      1260
     ggcacgagca tggcagcgcc ttatgtagcg ggtatcgcgg cgctgtaccg ttgccgtgcc      1320
     cctgacttga cggcgctcga ggtgagggat ttgatcctgt cgaatgcggt gaagctccct      1380
     cggtcgggaa cgcacaagac aggcaagggc ctggccgtat tcaggtga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page