(data stored in ACNUC30630 zone)

EMBL: CP000113.PE207

CP000113.PE207       Location/Qualifiers
FT   CDS_pept        complement(258083..258829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0211"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92986"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT0"
FT                   /protein_id="ABF92986.1"
FT                   /translation="MQLKDLKIIVTGGAQGMGAHFAQRLHEAGAQVAVGDVAEERLAAL
FT                   PAGIHRRKLDVSSEEDIVSFVNWAQGAMGGLNGLINNAGILRDALLVKKDRTTGEVKKL
FT                   STADWNAVIGVNLTGATLMVREVVAKVAESGQKGGVVVNMSSIARHGNRGQSNYVSAKA
FT                   ALAANTVTWSREFSPFGVRVGAVAPGMIETPMTQGMNQKARDALVSNIPVGRIGVPEDI
FT                   WLAVKFILECDYFNGRTIDVDGGLNF"
     atgcagctca aggacctgaa gatcatcgtc acgggcggcg cccagggcat gggcgctcac        60
     ttcgcgcagc gcctgcacga ggcgggcgcc caggtggccg tgggtgacgt ggccgaggag       120
     cgcctcgccg cgctgcccgc cggcatccac cgccgcaagc tggacgtgtc ctccgaggag       180
     gacatcgtct ccttcgtgaa ctgggcgcag ggcgccatgg gcggcctcaa cgggctcatc       240
     aacaacgcgg gcatcctccg tgacgcgctg ctggtgaaga aggaccggac caccggcgag       300
     gtgaagaagc tgtccaccgc ggactggaac gccgtcatcg gcgtcaacct cacgggcgcc       360
     acgctgatgg tgcgcgaggt ggtggcgaag gtcgccgagt ccggccagaa gggcggcgtg       420
     gtcgtcaaca tgtcgtccat tgcccgccac ggcaaccgcg gtcagtccaa ctacgtgtcc       480
     gcgaaggcgg cactggcggc caacaccgtc acctggtcgc gcgagttcag ccccttcggc       540
     gtgcgcgtgg gcgcggtggc cccgggcatg attgagacgc cgatgacgca gggcatgaac       600
     cagaaggccc gcgacgcgct ggtctccaac atccccgtgg gccgcatcgg cgtgcccgag       660
     gacatctggc tcgccgtgaa gttcatcctg gagtgcgact acttcaacgg ccgcaccatc       720
     gacgtggacg gcggcctcaa cttctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page