(data stored in ACNUC30630 zone)

EMBL: CP000113.PE210

CP000113.PE210       Location/Qualifiers
FT   CDS_pept        261610..262353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0214"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88337"
FT                   /db_xref="GOA:Q1DFS7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS7"
FT                   /protein_id="ABF88337.1"
FT                   /translation="MNRASSSQDRSGPVTPRGQKTRAKLLKAAESVFGEKGYERASIAD
FT                   ITRKGGVALGTFYVYFPDKQSIFVEVVDELGTRLRRLIAESVAGCEDRVDVERQGLRTF
FT                   FQFVRQHPNLYRVVRQAEFVDEACYRRYYDRFARGYVSGLTRAMEAGQVRRMDPEALAY
FT                   CLMGISDFLGMRWVLWEEDPGLERVLDTAMTLISHGLDPRASTGRNTVKSSAASKPKPK
FT                   LKPKPKPLKKNTLRPARRPARGARS"
     atgaatcggg cttcatcttc tcaagaccgc tccggacccg tcacgccgcg aggccagaag        60
     acgcgtgcga agctgttgaa ggccgcggag tcggtcttcg gtgagaaggg ctacgagcgc       120
     gcctccatcg cggacatcac gcgcaagggt ggcgtggcgc tcgggacgtt ctacgtctac       180
     ttccccgaca agcagtccat cttcgtcgaa gtggtggacg aactgggcac gcgcctgcgc       240
     cggctcatcg ccgagtccgt ggccggctgc gaggaccgcg tcgacgtgga gcgccagggc       300
     ctgcgcacct tcttccagtt cgtgcggcag caccccaatc tctatcgcgt ggtgcgccag       360
     gcggagttcg tggatgaggc ctgctaccgc cgctactacg accgcttcgc tcgcggctac       420
     gtgagcgggc tcacccgcgc catggaggcg ggccaggtgc ggcgcatgga cccggaggcg       480
     ctggcctact gcctcatggg catcagtgat ttcctcggca tgcgctgggt cctctgggag       540
     gaggacccgg ggctcgagcg cgtcctcgac accgcgatga cgctcatctc ccacggcctg       600
     gacccgcgtg cgtccacggg ccgcaacacc gtgaagtcct ccgccgcttc gaagccgaag       660
     ccgaagctga agcccaaacc gaagcccctg aagaagaaca ccctgcgtcc cgcccgccga       720
     ccggcgcgcg gcgcccggag ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page