(data stored in ACNUC30630 zone)

EMBL: CP000113.PE216

CP000113.PE216       Location/Qualifiers
FT   CDS_pept        267544..268734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0220"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90107"
FT                   /db_xref="GOA:Q1DFS1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS1"
FT                   /protein_id="ABF90107.1"
FT                   /translation="MSTSRAFTALLLAAGLSSAGCVRSYAHQPALSFQDLDYTSEGSKQ
FT                   PWPVKRIPLPRTANQYGMAVVPQIAYVDMPGSGPDAKAVVFIHGLGSYLKFWRAQLDAF
FT                   QKQGYRVIAVDLPGYGKSDKPGTFPYTMEAMADAVLELVDGLGLDKPVLAGHSMGGQTS
FT                   LSFAIRYPESLSGLVLASPAGFEKFSWREKEWFARAMSSEFIKSAPEASIWGSVRQANF
FT                   MHWRPELEWLIEERVRLAKSPEFDAYAYANVRTVRGLSHNDFVRDNLHRVTVPTVIIYG
FT                   TDDRLIPSPFLHGGETRGIMEYGASHIPGAKLVALEGCGHTVQLDCAERFNEAAFAFVR
FT                   DAAAGRIEVPSAPAKEEAPRPESPPAPASEPLTPESLPPPTPGQEGEPTPGVLPQP"
     atgagcacct cccgcgcatt cacggccctg ctcctcgcgg cggggctctc ctccgccggt        60
     tgcgtgcgct cgtacgcgca ccagcccgcg ctctccttcc aggatttgga ctacacctcc       120
     gagggctcga agcagccctg gccggtgaaa cggattccgc ttccgcgcac cgcgaatcag       180
     tacggcatgg ccgtggtgcc acagattgcc tacgtcgaca tgcccggcag cggcccggac       240
     gcgaaggccg tcgtcttcat ccacggcctg ggttcgtacc tgaagttctg gcgggcgcag       300
     ctggacgcct tccagaagca gggctaccgc gtcatcgcgg tggacctgcc cggctacggc       360
     aagtccgaca agcccggcac cttcccgtac accatggagg ccatggcgga cgcggtgctg       420
     gagttggtgg acggcctggg cctggacaag cccgtgctcg ccggtcactc catgggcggg       480
     cagacgtcgc tctccttcgc catccgctac ccggagtcgc tgagcgggct ggtgctggcg       540
     tcgcccgccg gcttcgagaa gttcagctgg cgggagaagg agtggttcgc gcgggcgatg       600
     agctccgagt tcatcaagtc cgcgccggag gccagcatct ggggcagcgt gcgccaggcc       660
     aacttcatgc actggcggcc ggagttggag tggctgattg aggagcgcgt gcggctggcg       720
     aagtcgcccg agttcgacgc ctacgcctac gccaacgtgc gcacggtgcg aggcctgtcc       780
     cacaacgact tcgtgcgcga caacctgcac cgcgtcaccg tgcccaccgt catcatctac       840
     ggcacggatg accggctcat ccccagcccc ttcctccacg gcggagagac gcgcggcatc       900
     atggagtacg gcgcgtccca cattcccggc gcgaagctgg tggcgctgga gggctgtggg       960
     cacaccgtgc agctcgactg tgcggagcgc ttcaacgagg cggccttcgc cttcgtccgt      1020
     gacgcggcgg cggggcgcat cgaggtgccg tccgctcccg cgaaggagga ggcgccgcgg      1080
     ccggagtctc ctcccgcgcc ggcgtccgag ccgctcacgc cggagagcct gcctccgccc      1140
     acgccgggcc aggaaggcga gccgacgccg ggcgtgctgc cccagccgta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page