(data stored in ACNUC30630 zone)

EMBL: CP000113.PE217

CP000113.PE217       Location/Qualifiers
FT   CDS_pept        complement(268797..269801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0221"
FT                   /product="lipase"
FT                   /note="identified by match to protein family HMM PF01674"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86273"
FT                   /db_xref="GOA:Q1DFS0"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS0"
FT                   /protein_id="ABF86273.1"
FT                   /translation="MPMRLRPSLYLASTLLLGIATGCGEDIASHEEALGAVEAAAVSTS
FT                   GATTHFRNWLSSNGYDSYDFIRTDLTGGSYGGKASASDTVTKQPVIFIHGNSDKAVGSV
FT                   FGQTGWTNSLEYFHSRGYKTSELYATTWGPANALQSANQYHSKQNVMKVRKFIEAVKAY
FT                   TGASKVDIIAHSMGVTLARKAILGGTAHDAADGGTYNVGVPLTSSVDTFVGIAGANLGL
FT                   TSCYMSGPSTPTCGSTNGLYPGYLFWGSVTGRSTYLNDLRSTSGYEGAFRYTIYSTADE
FT                   IIGYDGIVYGEYTSRIPGQTGEKRYTGYPYGHFNSKDLTAEVQYDMVVNHTIP"
     atgcccatgc gactgaggcc ttcgctgtat ctcgcgagca cgctgctgct tggcatcgcc        60
     accggctgtg gcgaggacat cgcgtcccac gaagaagcgc tcggcgcggt ggaagccgcg       120
     gcggtctcca cctccggcgc caccacccat ttccgcaact ggctgtcgtc caacggctac       180
     gacagctacg acttcattcg cacggacctc acgggcggca gctacggcgg caaggccagc       240
     gcctccgaca ccgtgacgaa gcagcccgtc atcttcatcc acggcaactc ggacaaggcg       300
     gtgggctcgg tcttcggcca gacgggctgg accaactccc tcgagtactt ccactcgcgg       360
     ggttacaaga cgagcgagct gtacgcgacg acgtggggcc cggccaacgc gctccagtcg       420
     gcgaaccagt accactcgaa gcagaacgtg atgaaggtgc gcaagttcat cgaggcggtg       480
     aaggcgtaca ccggggcctc gaaggtggac atcatcgccc actccatggg cgtgacgctg       540
     gcgcgcaagg ccatcctcgg cggcacggcc cacgacgcgg cggacggcgg cacatacaac       600
     gtcggcgtac cgctcacgtc ctcggtggac accttcgtcg gcatcgccgg cgccaacctg       660
     ggcctgacgt cttgttacat gtccggcccg tcgacgccca cctgcggctc caccaacggc       720
     ctgtacccgg gctacctctt ctggggcagc gtcaccggcc gctcgacgta cctcaatgac       780
     ttgcgctcga cgagcggtta cgagggcgcc ttccgctaca ccatctactc cacggcggac       840
     gaaatcatcg gctacgacgg catcgtctac ggtgagtaca cgtcacgcat ccccgggcag       900
     acgggtgaga agcgctacac cggctatccc tacggccact tcaactcgaa ggacctgacg       960
     gccgaggttc agtacgacat ggtggtcaac cacaccatcc cgtag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page