(data stored in ACNUC30630 zone)

EMBL: CP000113.PE224

CP000113.PE224       Location/Qualifiers
FT   CDS_pept        277365..277733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0228"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85907"
FT                   /db_xref="GOA:Q1DFR3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR3"
FT                   /protein_id="ABF85907.1"
FT                   /translation="MDKKLATTIGAAARVARTRLELTQADVAERIDVATEVYGRLERGG
FT                   MLPSVHTLLKLCHELHVSADELLGLSANAVNGGARPGEPPTSPQERPEVRRLLRTVRPL
FT                   EPAKVKLLGLVANALNRR"
     atggacaaga aactcgcaac cacaatcgga gctgccgcgc gcgttgctcg cacccgcctg        60
     gagctcaccc aggcggacgt ggctgagcgt atcgatgtgg ccaccgaggt ctacgggcgc       120
     ttggagcgcg gcgggatgct gcccagcgtg catacgctgc tgaagctgtg ccacgagctc       180
     cacgtctcag cggatgagct cctggggctc tccgcgaacg ccgtcaacgg gggcgcgcgt       240
     cccggtgagc cgcccacctc gccgcaggag cgccccgagg tccggcgcct gctgcgcacc       300
     gtgcgtccgc tggagcccgc gaaggtgaag ctgttggggc tggtggccaa cgcgctgaac       360
     cgccgctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page