(data stored in ACNUC30630 zone)

EMBL: CP000113.PE235

CP000113.PE235       Location/Qualifiers
FT   CDS_pept        288958..289803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90198"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ2"
FT                   /protein_id="ABF90198.1"
FT                   /translation="MSSVSPRQEGGPVDGVAAGRFVLQLGGVRVDDAMHPVTGRQRGAQ
FT                   DELGPGVGLHGVSGGDEAEVVERRAGARPAADVEDDIAARVPVSAEGDAARLRVPVERA
FT                   EREALGVLVDDAHGEGARALNLHRQLVVQCQRLAPAFRVTALEDAEFGRGELGEAHGHP
FT                   AHEFLGGDPAVADDCPVVALEQGACPFFRELKPAWLVGVCVHGLVRHLALCLHRSHHDG
FT                   DLFAGLHGAARRKSAACGGPVCPPWEGAWRRTSTRRAGRRSMSTWTCPRWCGRSTPRRH
FT                   "
     ttgtcttccg tctccccgcg ccaggaaggt gggcccgtgg acggtgtcgc cgccgggcgg        60
     ttcgtcctcc aactcggtgg tgtccgcgtg gatgacgcca tgcaccccgt caccggccgt       120
     cagcgcggcg cgcaggacga actcggtcca ggtgttggtc tgcatggcgt ctccggcggt       180
     gacgaagccg aggtagtgga acgtcgagcc ggagcgcgcc cggctgcgga tgtggaagat       240
     gacatcgccg cgcgcgttcc ggtaagcgcc gaaggtgatg cggcccgcct ccgggtgccc       300
     gtggagcgtg ccgagcgtga agctctgggc gtcctggtgg atgacgcgca cggcgaaggt       360
     gcccgcgccc tgaatcttca ccgtcagctc gtcgtccagt gccagcggtt ggcccccgcg       420
     ttccgggtga ctgcgctcga agacgcagag ttcggacggg gcgaactcgg cgaagcgcac       480
     ggccacccag cgcatgagtt cctcggggga gacccggcag tcgcggatga ctgcccagta       540
     gtcgcgctgg agcagggggc ctgccccttc ttcagggagc tgaagcccgc ctggctggtt       600
     ggcgtctgtg tgcatggact cgttcgccat ctcgcccttt gcctccatcg gtcacaccat       660
     gatggggacc tcttcgctgg gctgcatggc gcggcccggc ggaagagcgc tgcatgcggc       720
     gggcctgtct gcccgccctg ggagggcgca tggagacgga cgtcaacccg gcgagccggg       780
     cgtcggagca tgagtacctg gacgtgcccc cggtggtgcg ggcggagcac gccgaggcgt       840
     cactga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page