(data stored in ACNUC30630 zone)

EMBL: CP000113.PE238

CP000113.PE238       Location/Qualifiers
FT   CDS_pept        290816..291538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89001"
FT                   /db_xref="InterPro:IPR011750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP9"
FT                   /protein_id="ABF89001.1"
FT                   /translation="MTRFFWLREDEAATAAFSGSFNAAHKWCLPGVKCSACGTTWSSWG
FT                   NHYPLVDLSQLPERAAFEKARPEPFTEFSRLRELVRSLAPPDAELPPGAAFGPLVGTAS
FT                   GEFGPFTWQGTSLLLVRRDAMERLQAEGVRGLLGGQTELRFRKKESPELLDLQLEPRGL
FT                   LHPDCIPSDASPPCPTCGRHAFARPDAPILAAASLPADVDAFRLVNFATMIIGTDRFVD
FT                   AMRRLGLEGIACQELPTR"
     atgacccgat tcttctggct gcgtgaagac gaagcggcaa cggccgcctt cagtggaagc        60
     ttcaacgccg cgcacaagtg gtgtctgccc ggcgtgaagt gctccgcctg tggcacgacc       120
     tggagttcct gggggaacca ctatcccctc gtggacctgt cgcagctgcc ggagcgtgcc       180
     gcgttcgaga aggcccggcc ggagccgttc acggagttct cccgtcttcg ggaactggta       240
     cgctccttgg ctcctccgga tgcggagctg ccgcctggtg cggccttcgg gccattggtt       300
     ggcactgcgt ccggcgaatt cggtccattc acatggcagg ggacttcgct attgctcgta       360
     cgccgcgatg cgatggagcg cctgcaagcc gaaggtgtac gcggtctgct gggcggacaa       420
     acggaactgc gattccgcaa gaaggagtca ccggagttgt tggacctcca actggagcca       480
     cgcggcctgc tgcatccgga ttgcatccca tccgacgcat cgccgccgtg tccaacctgt       540
     gggcggcacg cctttgctcg acccgatgcc cccatcctcg ccgcagcttc gctcccggcg       600
     gacgtggacg cgttccggct cgtgaacttc gcgacgatga tcatcgggac cgaccggttc       660
     gtggatgcga tgaggcgcct cgggctggag ggaatcgcct gccaggaact tcctacccgc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page