(data stored in ACNUC30630 zone)

EMBL: CP000113.PE239

CP000113.PE239       Location/Qualifiers
FT   CDS_pept        complement(291528..292637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D69820"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87754"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP8"
FT                   /protein_id="ABF87754.1"
FT                   /translation="MADHLKTFFDARLVERLGASLHAAAPTFPRAAFIREAEKGLDGHE
FT                   LMDRARHIAGALHRALPQDYPEAVEVLLRSLGPRTEATEGGAMASFFYLPHTIFVAEHG
FT                   LEHFEPSMRAQHVLTQRFTAEFSIRPYLERHTAKTLARLREWTEDPSEHVRRLVSEGTR
FT                   TRLPWASRLREFQKDPTPVLALLERLKDDPALYVRRSVANNLNDIGKDHPALLVQVATA
FT                   WMKNATPEREWLVRHALRSSIKRGEPAALAVVGARPPSGIEARVTQLPRRAALGSTVEV
FT                   HFEVTNRSKQQQTLVVDLAVHFQKANGEARPKVFKVRELLLGPGQAETVSKRVSFAQLS
FT                   TRKHYAGPHRFEALVNGQGLPLGVVEVSG"
     atggcggacc acctcaagac cttcttcgac gcgcggcttg tcgaacgcct cggcgcgtca        60
     ctccacgccg cggcgccgac cttccctcgc gccgcgttca tccgagaggc cgagaagggc       120
     ctggatggcc atgagttgat ggaccgggcg cgtcatatcg ctggtgcgct gcaccgtgcg       180
     ctgccccaag actacccaga ggcggtggag gtgctgctgc gctcgctcgg cccccggacg       240
     gaggccacgg agggaggggc catggcttcc ttcttctatc tgccgcacac gattttcgtg       300
     gcggagcatg gcctggagca cttcgagccg tccatgcgcg cccagcacgt gctcacccag       360
     cgattcaccg cggagttctc catccggccc tacctggagc ggcacaccgc gaagacgctg       420
     gcccgcctgc gcgagtggac agaggacccg agcgagcatg tccggcggct cgtgtcagag       480
     ggcacgcgca cgcgcctgcc gtgggcctca cggctgcgcg agttccagaa ggaccccaca       540
     ccggtgctcg cgctgctgga gcggctgaag gacgacccgg cgctttatgt gcgccgctcg       600
     gtggccaaca acctgaatga catcggcaag gaccaccctg ccctgctggt gcaggttgcg       660
     acggcgtgga tgaagaacgc cacgccggag cgggagtggc tggtgcgcca tgcgctgcgc       720
     tcgtccatca agcgcggaga gcccgcggcg ctggcggtgg tgggcgcgcg gccgccgtca       780
     ggcatcgagg cccgcgtgac gcagttgccc cgccgcgcgg cactgggcag cacggtggag       840
     gtccacttcg aggtgaccaa ccgctcgaag cagcagcaga cgctggtggt ggacctcgcg       900
     gtgcatttcc agaaggcgaa cggcgaggcg cggcccaagg tgttcaaggt gcgcgagctg       960
     ctgcttggcc cgggacaagc ggagacggtg agcaagcgcg tctccttcgc gcagctctcc      1020
     acacgcaagc actacgccgg gccgcaccgc ttcgaggccc tggtgaacgg acaggggttg      1080
     ccgctgggtg tcgtcgaggt cagcgggtag                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page