(data stored in ACNUC30630 zone)

EMBL: CP000113.PE246

CP000113.PE246       Location/Qualifiers
FT   CDS_pept        298773..299981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0251"
FT                   /product="Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88972"
FT                   /db_xref="GOA:Q1DFP1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP1"
FT                   /protein_id="ABF88972.1"
FT                   /translation="MSLFSPAGTERRLALRTGLFVAVGLAVASVVVMVIGQQSRLFERK
FT                   TMYRAYFANVQGLNDESPVWLGGLNVGRVTGIVFSPDPNDPRLEVQFQVSSRYTDRVRQ
FT                   DSVAQLSSMGVLGDKAVDISLGSPTSPPVEAGGVLKSSTGGDLSSLLSGASQVMENSVA
FT                   ISKSLRAAVETYANPEMANDVTRGVAALRALLEEVAKGEGVLHALIYDKQAGREVRGLL
FT                   ANASSAAARVDGAVGELEGILREVRTGDGTAHALVYGQDGAKALTELGAAAGQLAGLIE
FT                   DAKKSPNGAVHQLVYGDASGMFADLGSAAADLKKITATVAKGDGTVGGLISDPTVYEDL
FT                   REVIGNVKRNRILRALVRFSLSNRQDLEQVGKVKGVEPRSEAPDAAPAETAPSAPGESA
FT                   AQP"
     atgagcctgt tctctcccgc tggaaccgag cgccgcctgg cgctgcgcac gggtctgttc        60
     gtcgccgtcg gactggcggt cgccagcgtg gtggtgatgg tcatcggcca gcagtcgcgc       120
     ctgttcgagc gcaagacgat gtatcgcgcc tacttcgcca acgtgcaggg cctcaatgat       180
     gagtcgcccg tctggctcgg cggtctcaac gtggggcggg tgacgggcat cgtcttctcg       240
     cccgacccga atgacccgcg gctggaggtc cagttccagg tgtcgtcgcg ctacacggac       300
     cgcgtgcgtc aggactcggt ggcgcagttg tccagcatgg gcgtgctggg cgacaaggcg       360
     gtggacatct ccctgggcag ccccacgtca ccgccagtgg aggcgggtgg ggtgctcaag       420
     tcgtccacgg gcggtgactt gtcctcgctg ctgagcgggg cgtcgcaggt gatggagaac       480
     tcggtggcca tcagcaagtc gctgcgggcg gcggtggaga cgtacgccaa cccggagatg       540
     gccaacgacg tgacgcgcgg cgtggcggcg ctgcgggcgc tgctggaaga ggtggcgaag       600
     ggcgagggcg tgctgcacgc gctcatctac gacaagcagg ccgggcgcga ggtgcggggg       660
     ctgctggcca acgcgtccag cgcggcggcg cgggtggatg gcgcggtggg cgagctggaa       720
     gggattctgc gcgaggtgcg cacgggagac ggcacggccc acgcgctcgt ctacggccag       780
     gacggcgcca aggcgctgac ggagctgggg gcggcggccg ggcagctggc ggggctcatc       840
     gaggatgcga agaagagtcc caacggggcg gtgcaccagc tggtgtacgg cgacgcgagc       900
     ggcatgttcg cggacctggg cagcgcggcg gcggacctga agaagattac ggcgaccgtg       960
     gcgaagggag acggcaccgt gggcgggctc atcagcgacc cgacggtgta cgaggacctg      1020
     cgtgaggtga ttggcaacgt gaagcgcaac cgcatcctcc gcgcgctggt gcgcttctcc      1080
     ctgagcaacc ggcaggattt ggagcaggtg ggcaaggtga agggcgtgga gccacgctcc      1140
     gaagcgcccg acgcggctcc ggcggagacg gcgccctcgg cgcctgggga gtctgcggcc      1200
     caaccctag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page