(data stored in ACNUC30630 zone)

EMBL: CP000113.PE255

CP000113.PE255       Location/Qualifiers
FT   CDS_pept        307792..309939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0260"
FT                   /product="putative cation transporter/universal stress
FT                   family protein"
FT                   /note="identified by similarity to GB:AAM80527.1; match to
FT                   protein family HMM PF00582; match to protein family HMM
FT                   PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92456"
FT                   /db_xref="GOA:Q1DFN2"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN2"
FT                   /protein_id="ABF92456.1"
FT                   /translation="MHTNALALLILQLIVIIGLSRLIGRGARWLGQPLVIAEVVAGIVL
FT                   GPSLLGWLAPDIMNGLFPASSMPVLTMLSQVGLVLFMFLIGLELDPQLLKGRGHASVAI
FT                   SHSSIVVPFALGAGAGALWLYRSLSSPEVPFSSFVLFMGVAMSITAFPVLARILTERGL
FT                   LQSKVGTVAIACAAVDDVTAWCLLAFVVSIVRASSLAQAALTTVMALGYIAFMLMVVRP
FT                   FLARLGARVASREGLTQNVVAGTLVLLLASAGVTELIGIHALFGAFLFGAVIPKEGRLA
FT                   ETLAERLEDVAVVLLLPVFFAFSGLRTQIGLLNTAEDWLTCGVIIVLACLGKFGGSAVA
FT                   ARMTGLRWREASAIGILMNTRGLMELIVLNIGLDLGVISPQLFTMMVLMALVTTFITTP
FT                   LLKWIYPLEEIARERVVVPLPVEPGPPPYSVLMCVSHGQAGPGMATLARSLSGREEGAQ
FT                   LHALHLVSPERASLRPAQQRAPEEDSALMPLLWRAVSLGLSVRPLSFVSAEPAQDICRT
FT                   AKARRADLVLLGWHKPLFSQTMLGGTVREVMQEASGPVAVLVDRGLSDIKRVLVPFAGS
FT                   RHDRAALALARRLRQQADAEVTVLHVTSDLGGNGGARAQVEALFPANEGGVTLKEVRSD
FT                   APDEAALGEARHGYDLVIVGIGAQWGLEDKVFGLQRERIIRDAPGSLLVVSDASPATAA
FT                   ESTSEAANDGATAVRVLPARS"
     atgcacacca acgcactcgc gctgctgatc ttgcagctca tcgtcatcat cggcttgtcg        60
     cggctcatcg gccgcggcgc gcggtggttg ggacagccgt tggtcatcgc ggaggtggtg       120
     gccggaatcg tcctggggcc ctcgctgctg ggctggctgg cgccggacat catgaacggg       180
     ctgttcccgg cctcgtcgat gccggtgctg acgatgctca gccaggtggg cctggtgctg       240
     ttcatgttcc tcattggcct ggagctggac ccccagctac tcaagggccg ggggcatgcg       300
     tcggtggcca tcagccactc cagcatcgtc gtccccttcg cgctgggcgc gggcgcgggc       360
     gcgctgtggc tctacaggag cctgtcgtcg ccagaggtgc cgttctcctc gttcgtgctc       420
     ttcatgggcg tggcgatgag catcaccgcc ttcccggtgc tggcgcgcat cctcaccgag       480
     cggggcctgc tccagtcgaa ggtgggcacg gtggccattg cctgcgcggc ggtggatgac       540
     gtcaccgcgt ggtgcctgct ggccttcgtc gtctccatcg tccgtgcgtc cagcctggct       600
     caggcggcgc tcaccacggt gatggcgctg ggctacatcg ccttcatgct gatggtggtg       660
     cggcccttcc tcgcgcgcct gggcgcgcgg gtggccagcc gtgagggtct cacccagaac       720
     gtggtggcgg gcacactggt gctgctgctg gcgtccgcgg gcgtgacgga gctcatcggc       780
     atccacgcgc tcttcggtgc cttcctcttc ggcgcggtga ttccaaagga aggccgtctg       840
     gcggagacgc tggcggagcg gctggaggac gtggcggtgg tgttgctgct gcccgtcttc       900
     ttcgccttca gcggcctgcg cacgcagatt ggcctgctaa acaccgcgga ggactggctg       960
     acgtgcggcg tcatcatcgt gctggcctgc ctgggcaagt tcggcggcag cgcggtggcg      1020
     gcgaggatga cgggcctgcg gtggcgcgag gcgagcgcca tcggcatcct gatgaacacg      1080
     cgtgggttga tggagctcat cgtcctcaac atcggcctgg acctgggcgt catctcaccc      1140
     cagctgttca cgatgatggt gctgatggcg ctggtgacga cgttcatcac cacgccgctg      1200
     ctgaagtgga tctacccgct ggaggagatt gcccgcgagc gcgtggtggt gccgctgccg      1260
     gtggagccgg gccctccgcc ctacagcgtg ctgatgtgcg tgtcgcacgg gcaggcgggg      1320
     ccgggcatgg ccaccctggc gcgctcgttg tcggggcgtg aagagggcgc gcagcttcac      1380
     gcgctgcatc tggtgtcccc ggagcgcgcg tccctgcgcc cggcgcagca gcgggccccc      1440
     gaggaggaca gcgcgctgat gccgctcttg tggcgggccg taagcctggg gctctccgtg      1500
     cggccgttgt cgttcgtctc cgccgagccg gcccaggaca tctgccgcac ggcgaaggcc      1560
     cggcgcgcgg acctggtcct gctggggtgg cacaagccgc tcttcagcca gacgatgctg      1620
     ggcggcacgg tgcgtgaggt gatgcaggag gccagtggcc cggtggcggt gctggtggac      1680
     cggggcctgt cggacatcaa gcgcgtgctg gtgcccttcg ccggcagccg gcatgaccgc      1740
     gcggccctgg ccctggcccg gcggctgagg cagcaggcgg acgccgaggt gacggtgctg      1800
     cacgtgacgt cggacctcgg cggcaacggc ggagcccggg cgcaggtgga ggcgctgttc      1860
     ccggcgaacg agggcggcgt gacgttgaag gaggtgcgca gcgacgcgcc ggacgaggcc      1920
     gccctgggtg aggcgcgcca cggctatgac ctggtgattg tcggcatcgg cgcgcagtgg      1980
     gggctggagg acaaggtctt cggcctgcag cgcgagcgca tcatccggga cgcgccgggc      2040
     tcgctgctgg tggtgtccga cgcgtctccc gccacggcgg cggagtccac ctccgaagcc      2100
     gccaacgacg gggccactgc agtccgggtg ttgcccgcga ggagctga                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page