(data stored in ACNUC30630 zone)

EMBL: CP000113.PE270

CP000113.PE270       Location/Qualifiers
FT   CDS_pept        complement(328725..329477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0275"
FT                   /product="tonB system transport protein ExbB/TolQ"
FT                   /note="identified by similarity to SP:P18783; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92421"
FT                   /db_xref="GOA:Q1DFL7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL7"
FT                   /protein_id="ABF92421.1"
FT                   /translation="MNFNLRDIYNHMGVFALGIAWTLILFAVASLAVFFERLFVFFRSR
FT                   SISKQFASRAGPLLTQHQHEALVKEAEATKGSHLAMLLGGGMKHFLAKSRVPAGKLGPV
FT                   ELTRRELVRINERVSADVRRGMSVLATVGSVAPFVGLLGTVVGIIEAFSGIAKEGSGGL
FT                   GAVSAGIAEALVVTALGLLVAIPAVLMFNFLSTRADSLQLSLDAARSEFMDYLEDLGPQ
FT                   KPVATNGAAVATGPELAARKESRDVHPA"
     atgaatttca atctcaggga catctacaac cacatgggtg tgttcgcgct gggcatcgcg        60
     tggaccctca tcctcttcgc cgtcgcgtcc ctcgcggtgt tcttcgaacg cctcttcgtc       120
     ttcttccgct cgcgctccat ctccaagcaa ttcgcgtccc gcgccggtcc gctcctcacc       180
     cagcaccagc acgaggcgct ggtgaaggag gcggaggcca ccaagggcag ccacctggcc       240
     atgctgctgg gcggtggcat gaagcacttc ctcgcgaagt cccgcgtgcc ggccggcaag       300
     ctgggcccgg tggagctcac gcgccgtgag ctggtccgca tcaacgagcg cgtcagcgcc       360
     gacgtgcgcc gcggcatgtc cgtgctcgcc accgtcggct cggtggcgcc cttcgtcggt       420
     ctgctcggca cggtggtggg catcatcgag gccttctccg gcatcgccaa ggagggctcc       480
     ggcggcctgg gcgcggtgtc cgccggtatc gccgaggcgc tcgtcgtcac ggcgctgggt       540
     ctgctcgtcg ccatccccgc ggtgctgatg ttcaacttcc tctccacccg cgcggattcg       600
     ctccagctct ccctggacgc cgcgcggagc gagttcatgg actacctgga ggacctgggg       660
     ccgcaaaagc ccgtggccac caacggcgcc gcggtggcca cgggcccgga gctggctgct       720
     cgcaaggagt cccgcgatgt ccaccccgcg tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page