(data stored in ACNUC30630 zone)

EMBL: CP000113.PE273

CP000113.PE273       Location/Qualifiers
FT   CDS_pept        complement(331739..333130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0278"
FT                   /product="mercuric reductase, truncated"
FT                   /note="identified by similarity to SP:P16171; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF01134; match to protein family HMM PF01266; match to
FT                   protein family HMM PF02852; match to protein family HMM
FT                   PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92860"
FT                   /db_xref="GOA:Q1DFL4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL4"
FT                   /protein_id="ABF92860.1"
FT                   /translation="MAEAFDVVVIGAGPAGEVAGARAAEAGLSVALVEHELLGGECSYW
FT                   ACIPSKALLRPSEARWLAEHAAGVREKLQEGIDARAVLAHRDSMVNNYQDDSQVKWAEN
FT                   AKLKVVRGTGKLTGPRKVRVEDKDGAVRELEARKAVVLATGSHPRIPDIPGLKDAQPWD
FT                   NRQGTAARQVPKRLVVLGGGAVGVELAQAWRSLGSEVTLVQRGKRLLSRAEPFAGEQVA
FT                   QALRDAGARVLLGMNATRVQRPGGKGEVTVTLSNGEQVVADEILVAMGRVPRTEGIGLE
FT                   TVGLVGGKPVEVDDQLRAKGVDGGWLYACGDTNGRNLLTHMGKYQARMVGDVIAGKQAR
FT                   AWADAKATPQVVFTHPQVASVGLTEAKAREAGLPVRTVEQQLQDVSGTSLVGKGLTGTV
FT                   KWVVDEKRRVLVGATFTGPEVGEMLHAATIAVAGEVPLDTLWHAVPSFPTMSEVWLKLL
FT                   EAYGL"
     atggcggaag cgttcgacgt ggtggtgata ggggcaggcc ccgcgggtga ggtcgccggt        60
     gcgcgcgccg cggaggccgg gctgtcagtg gcgttggtgg agcatgagct gctcggcggc       120
     gagtgctcat actgggcctg catccccagc aaggccttgc tgcgcccgag cgaagcgcgg       180
     tggctggcgg agcatgccgc cggcgtgcgc gagaagctcc aggagggcat cgacgcgcgt       240
     gcggtgctgg cccaccggga ttcgatggtc aacaactacc aggacgactc ccaggtgaag       300
     tgggccgaga atgcgaagct gaaggtggtg cggggcaccg gcaagctcac tggccctcgc       360
     aaggtgcgtg tggaggacaa ggacggcgcc gtgcgggagc tggaggcccg aaaagccgtg       420
     gtgctggcca ccggcagcca tccgcgcatc ccggacatcc cggggctgaa ggacgcccag       480
     ccctgggaca accgccaggg cactgcggcg aggcaggtgc ccaagcggct ggtggtgctg       540
     ggcggcggcg cggtcggggt ggagctggcc caggcgtggc gctcgctggg ctccgaggtg       600
     acgctggtgc agcgcggaaa gagattgctg tcccgcgcgg agcccttcgc cggagagcag       660
     gtggcccagg cgctgcgaga tgccggcgcg cgcgtgctgc ttggaatgaa cgcgacgcgc       720
     gtccagcggc ccggcggcaa gggcgaggtg acggtgacgc tgtccaatgg cgagcaggtc       780
     gtcgcggacg aaatcctggt ggccatgggc cgcgtgcccc gcacggaagg aatcgggctg       840
     gagacggtgg ggctcgtggg cggcaagccc gtggaggtgg atgaccagct ccgcgcgaag       900
     ggcgtggacg gcggctggct ctacgcgtgc ggcgacacca atggccgcaa cctcctcacc       960
     catatgggca agtaccaggc ccgcatggtg ggcgacgtca tcgcgggcaa gcaggcaagg      1020
     gcctgggcgg acgcgaaggc caccccgcaa gtcgtcttca cccacccaca ggtggccagc      1080
     gtgggcctca ccgaggccaa ggcacgcgag gccgggctgc cggtacgcac ggtggagcag      1140
     caactccagg acgtgtccgg cacctcgctg gtgggcaagg gcctcactgg caccgtgaag      1200
     tgggtggtgg acgagaagcg ccgggtgctc gtgggcgcca cgttcaccgg gccggaggtg      1260
     ggagagatgc tccatgcggc caccatcgcc gtggcggggg aggtgccgct cgacacgttg      1320
     tggcacgcgg tgccgtcgtt ccccaccatg agcgaggtgt ggttgaagct gctggaggcg      1380
     tacggcctct ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page