(data stored in ACNUC30630 zone)

EMBL: CP000113.PE279

CP000113.PE279       Location/Qualifiers
FT   CDS_pept        337885..338379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0285"
FT                   /product="ankyrin repeat protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86462"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK8"
FT                   /protein_id="ABF86462.1"
FT                   /translation="MLPRGGLTMSLFDAVLAGDRDAVESHLSAGADPNPFDEEGRTPLM
FT                   AAARAGRADLVQRLLDAGADPELTDSIGESALIMAAAHGHTEVCQWLMPHARADDQDLA
FT                   RTLLSGLGITDLRLDAPPPQDNSFRRKLASAGAYVSGKLGDDGATKRLERVLRSEKQRK
FT                   P"
     atgctgccgc gcggaggtct gacgatgtcc ctcttcgatg ccgtgctggc gggcgaccgt        60
     gacgccgtgg agtcccacct gtccgctgga gcggacccga accccttcga cgaggagggg       120
     cgcacgccgc tgatggccgc ggcccgcgcg gggcgagcgg acctggtgca acgcctcctg       180
     gatgcgggag cggaccccga gctgacggac agcatcggcg agtccgcgct catcatggcc       240
     gcagcgcacg ggcacaccga ggtctgccag tggctgatgc ctcacgcgcg cgcggatgac       300
     caggacctgg cccgcacgct gctctccggc ctgggcatca ctgacttgcg cttggacgcg       360
     ccgcctccgc aggacaacag cttccgccgc aagctcgcct ccgcgggggc gtacgtctcc       420
     ggcaagctgg gagacgacgg cgccacgaag cggctggagc gcgtcctgcg ctcggagaag       480
     cagcgcaagc cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page