(data stored in ACNUC30630 zone)

EMBL: CP000113.PE290

CP000113.PE290       Location/Qualifiers
FT   CDS_pept        complement(349748..350689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0296"
FT                   /product="peptidase, S1C (protease Do) subfamily"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90831"
FT                   /db_xref="GOA:Q1DFJ7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ7"
FT                   /protein_id="ABF90831.1"
FT                   /translation="MAPFRGLYLVPRKEHTMSTGLLQSLSHSLASIVERTAPGIVRVET
FT                   RRRRGTTGIVWDAEGHILTTSQAVEHEGRLPIGLPDGRTVSAEFVGRDASTDLALLKAE
FT                   ATGLAPLTSAPLDDVKVGHLVIAVGRPGRTARATLGMVSTHGEGWRTHAGGRVERYLET
FT                   DADLPPGFSGGALVDTEGRLVGLLTAAFSRTAAVVIATDTLTRVIASLKEHGGIRRGYL
FT                   GVGAYPVRLPPHLGTGNEHGLICLSVDPNGPAHDAGLLLGDVLVSLGGQPLHGVEDLLG
FT                   ALSDEKVGTTLQVRVLRAGEVREVPITVGKRS"
     gtggcgcctt ttcgaggcct ttaccttgtg cctcgaaagg aacacaccat gtccaccggc        60
     ctcctccagt cgctgtccca ctccctcgcc tccatcgtcg agcgcaccgc gcctggcatc       120
     gtccgcgtgg agacgcggcg caggcgcggc accaccggca tcgtctggga tgccgagggc       180
     cacatcctca ccaccagcca ggccgtggag cacgagggcc ggctccctat cggcttgccg       240
     gatggccgca ccgtctccgc cgagttcgtc ggccgcgacg ccagcaccga cctggccctg       300
     ctcaaggccg aagccaccgg cctcgcgccg ctgacctccg cgccgttgga tgacgtgaag       360
     gtcggtcacc tcgtcatcgc cgtgggccgc cctggccgca cggctcgcgc gacgctcggc       420
     atggtcagca cccacggcga gggctggcgc acccatgccg gaggccgcgt ggagcgctac       480
     ctggagacgg atgccgacct cccgcccggc ttctccggcg gcgcgctggt ggacaccgag       540
     ggacgccttg tcggtctgct caccgccgcc ttctctcgca ccgccgccgt cgtcatcgcc       600
     acggacacgc tcacgcgcgt gattgcatcg ctgaaggaac acgggggcat ccggcgtggc       660
     tacctgggcg tgggcgccta ccccgtgcgt ctgcccccac acctgggcac ggggaacgaa       720
     cacggcctca tctgcctctc cgtggacccg aacggcccgg cgcatgacgc gggtctgctg       780
     ctcggagacg tcctggtgag tctgggaggt cagcccctcc acggcgtgga ggacctgctc       840
     ggagccctga gcgacgagaa ggtgggcacc accctccagg tccgcgtgct gcgcgccgga       900
     gaggttcgcg aagtgcccat caccgtgggc aagcgctcgt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page