(data stored in ACNUC30630 zone)

EMBL: CP000113.PE292

CP000113.PE292       Location/Qualifiers
FT   CDS_pept        351910..352929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92407"
FT                   /db_xref="GOA:Q1DFJ5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ5"
FT                   /protein_id="ABF92407.1"
FT                   /translation="MAQAHGLKSLLGLTKETKPASRLVTVSRRSRLFGQIRRICGRVRT
FT                   TRRSTTCCPCQGSKCVEVLIDWVDPGGCELGTCCSEMSGAPQMFRHFRTARCTTASERQ
FT                   GGRPDSHVCYLAADSCLLWQPTRQGSGPRNSSPAASPWPARPYVLLELHDGERKVSLME
FT                   ETGERTMGQPQGVVQGDRREFEELLKDYDTALLTTRGADGHFHTRPMAVAKKHKSGTVL
FT                   WFATWADTQKVQDLESDPHCSLAFHASEDSATYLSVSGVAEVVRDRRAIHDLWEPGWKP
FT                   WFPQGPDEGDIALLRFTPEHAEYVHPAGGKLKVLFSTAKALVTKQRPDIAPKKELDLH"
     gtggctcaag cacacgggct caaatcgttg cttggattga ccaaggaaac gaagcccgcg        60
     tccaggttgg ttacagtgag tcgaaggtcg aggttgttcg ggcagatccg ccgtatctgc       120
     ggtcgagtcc gaacaacacg acggtcgaca acttgctgtc cttgccaagg ttctaagtgc       180
     gtcgaagtcc ttatcgactg ggttgaccct gggggatgcg agctgggaac ttgctgttcg       240
     gaaatgtcgg gggcacccca aatgttccga catttccgaa cagcgcggtg tacgaccgcg       300
     tcggagaggc agggcggaag accggattct cacgtttgct atctggctgc ggacagctgc       360
     ctgttgtggc aaccaacccg ccaagggagc ggtccacgca actccagtcc tgctgcttcc       420
     ccctggcccg cgcgtcccta cgttctcctg gaacttcacg atggcgaacg aaaggtcagc       480
     ctcatggaag agacaggcga gcgcacgatg ggacagccgc agggtgtcgt ccagggagac       540
     cgccgggagt tcgaggaact gctgaaggac tatgacaccg ccctcctcac cacccggggt       600
     gcggacggac actttcacac gcggcccatg gcggtggcga agaagcataa gtccggcacc       660
     gtgctctggt tcgccacctg ggcggacacg cagaaagtgc aggacctgga gtcggacccg       720
     cactgctcgc tcgctttcca cgcgtcggag gacagcgcca cgtatctctc cgtgtcgggt       780
     gtggcggaag tcgtccgcga ccggagggcc atccatgact tgtgggagcc cggctggaag       840
     ccctggttcc cacagggccc ggatgagggt gacatcgccc tgttgcgctt cacgcccgag       900
     cacgctgaat acgtccaccc ggcaggcgga aagctcaagg tgctcttcag caccgcgaag       960
     gcgttggtga cgaagcagcg ccccgacatc gcgcccaaga aggagttgga cctgcactga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page