(data stored in ACNUC30630 zone)

EMBL: CP000113.PE295

CP000113.PE295       Location/Qualifiers
FT   CDS_pept        complement(354980..356287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0301"
FT                   /product="putative asparagine synthetase"
FT                   /note="identified by match to protein family HMM PF00733"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92050"
FT                   /db_xref="GOA:Q1DFJ2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ2"
FT                   /protein_id="ABF92050.1"
FT                   /translation="MSHASGGMLATLPHYQSLARLAPSVWRLNPPGLAPEAVAAFLRHA
FT                   LPPDESVFQGVRRVPGALPRVRRSEGTPETREDEDRLAERLVAALADSVGKHLAAGAVD
FT                   VSLSGGVDSAALCALAARQAPGRVRAWTMDVHFADATERRNARTVANTAGVELVDVSVP
FT                   DAVLPELFEPAVLSQETAILNARAVASHAFYAEARRQGASTLLSGAGADEVLMGNPAAF
FT                   AGAAARVTEDRRLVHKVLHPGPVDNLGVDLRVLRLPWDAELASGDEDHPEEVRYAAWVL
FT                   WELVLPPELRGASAHGVNVCTPYLDADFADVALGLPLGVLARHGAGKWLFRHAVRTLVP
FT                   DEVRLARKTPRYAHTALSSPVRARWLELYREWLTPARLAPLECIDAGATRALLERYARL
FT                   AADAPEASAMDRLLMRLCSLAMLHAHASARPPCPES"
     gtgtctcacg cttccggcgg aatgctcgcc accctgcccc actaccagtc attggcgcgc        60
     ctggcgccgt ctgtgtggcg gctgaatccc ccggggctgg caccggaggc cgtcgctgca       120
     ttcctgcgcc acgcgctgcc tcccgacgaa agcgttttcc agggcgtgcg ccgggttccg       180
     ggcgcattgc ctcgcgtgcg tcggagcgag gggactccgg agacacgtga ggatgaagac       240
     aggctggcgg aacggctcgt ggccgcgctg gcggacagcg tgggcaaaca cctggcggcg       300
     ggcgcggtgg acgtgagcct gagcggcggc gtggacagcg ccgctttgtg cgccctggcc       360
     gcgcggcagg cgcccgggcg cgtgcgcgcc tggaccatgg atgtccactt cgcggatgcc       420
     acggagcgac ggaatgcccg gacggtggcg aacacagccg gagtcgagtt ggtcgacgtg       480
     tccgttccgg acgcggtgct gccagagctg ttcgagcccg ccgtcctgag ccaggagacg       540
     gccatcctca acgcccgcgc cgtggccagc catgccttct acgcggaggc ccgaaggcag       600
     ggcgcctcca cgttgctgag cggcgcgggc gcggatgagg tgctcatggg caacccggcg       660
     gcgttcgcgg gtgcggcggc ccgtgtgacg gaggaccggc gcctcgtgca taaggtgctg       720
     cacccagggc ctgtggacaa cttgggggtg gatctgcggg tacttcgcct tccctgggac       780
     gcggagctgg cttccggtga cgaggatcac cccgaagagg tccgctacgc ggcctgggtg       840
     ctgtgggagc tggtgctgcc tcccgagctc cggggtgcga gcgcacatgg cgtgaacgtg       900
     tgcacgccct acctggacgc ggacttcgct gacgtggcgc tgggactccc attgggcgtg       960
     ctcgcgcggc acggggccgg caagtggctc ttccggcatg cggtgcgcac gctggtaccg      1020
     gatgaggtcc ggttggcccg gaagacaccg cgctatgcgc acaccgcgct ctccagcccc      1080
     gttcgtgcgc gttggctgga gctgtaccgg gaatggctca caccggcccg gctggcgccg      1140
     ttggagtgca tcgacgcggg cgcgacccgg gcgctactgg agcgctacgc acgtctggcc      1200
     gccgacgctc ccgaggcgag tgccatggac cggctgttga tgcggttgtg ctccctcgcc      1260
     atgctccacg cccacgccag cgcccgcccc ccatgtcccg aatcctga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page