(data stored in ACNUC30630 zone)

EMBL: CP000113.PE299

CP000113.PE299       Location/Qualifiers
FT   CDS_pept        complement(360460..361779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92315"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI8"
FT                   /protein_id="ABF92315.1"
FT                   /translation="MAGVTEVLPADLRVAPRANIRRDTSSQRPHIPWAESIAQGLARFA
FT                   SLADEDAARADLDARLSFLRGALRDSPYHARRLHAAGIHPGDLQTLDDLSHLPFLDRGA
FT                   LAANWDAVPTLPADADDCVVVKSSGSTGAPVNVVRDRRDCLHMWAVLRFLVARAGAVLP
FT                   SHPRVVLLDALPGGLEYSVRLPILHDGALHRISVLREDALQRLRRVRPAVLFSDPEGLR
FT                   WLAAQRDVPSPELVLTSAQHLPAGLRAELANAVPAPVLNYYATTETGPLAWECLRPEAP
FT                   GRFHVLAPDVWLEPEQDEVVVTRLRPSVLPLLRYLPGDAGSVRRDACACGFHGWTLEHF
FT                   GGRGASHFATPSGREVDAWALAWVFKHHALRGFRLTQVDVSHFQLELAGASHADVAPLR
FT                   ERLTGALRNLGWTQARLDVCHVEVSALAVGTKPQPFRRLR"
     gtggcgggag tgacggaagt cctgcccgcg gacctgcgcg tcgcgcctcg cgcgaacatc        60
     cgccgggaca cctcctcgca gcgcccccac atcccctggg ccgagtccat cgcccaggga       120
     ctggcccgct tcgcgtccct ggctgacgag gacgcggccc gcgcggacct ggacgcccgg       180
     ttgtccttcc tgcgcggtgc gctgcgggac tcgccgtacc acgcccggag gctccacgcg       240
     gcgggcatcc acccgggtga cctccagacg ctggacgacc tgagccacct gcccttcctg       300
     gaccgcgggg ccctggccgc gaactgggac gcggtgccca cgctgccggc ggacgccgat       360
     gattgcgtgg tggtgaagag ctccgggtcc accggagcgc cggtgaacgt ggtgagggac       420
     cggcgcgact gcctgcacat gtgggccgtg ctgcggttcc tcgtggcgcg cgcgggagcg       480
     gtgctgccct cgcatccccg ggtggtgcta ctggacgcgc tgccgggcgg gctggagtac       540
     tcggtgcgcc tgcccatcct ccacgacggc gcgctgcacc gaatctccgt ccttcgcgag       600
     gacgcgctcc aacgcctgcg ccgcgtgcgg cctgccgtgc tcttctccga cccggaagga       660
     ctgcggtggc tggcggccca gcgcgacgtg ccctcgcccg agctggtgct cacctccgcg       720
     caacacctgc ccgccggcct gcgcgcagag ctggcgaacg cggtgcccgc gcctgtcctc       780
     aactactacg cgacgacgga gacgggaccg ctggcctggg agtgcctgcg gcccgaggct       840
     cctggccggt tccacgtcct ggctccggat gtctggttgg agcccgaaca ggacgaggtg       900
     gtggtgacgc ggctgcgtcc cagcgtgcta ccgctgctgc gctacctccc gggcgacgcg       960
     ggcagcgtgc ggcgtgacgc ctgcgcttgt gggtttcatg gatggacgct ggagcacttc      1020
     ggcgggcgcg gagccagcca cttcgccacg ccttcgggcc gggaggtgga tgcctgggcg      1080
     ctggcctggg tgttcaagca ccatgcgctg cgtggcttcc gactgacaca agtggacgtc      1140
     tcgcacttcc aactggagct ggcgggagcg agccatgcgg acgtggcgcc actgcgcgag      1200
     cggctcaccg gcgccttgcg gaacctgggt tggacgcagg cgcgcctgga cgtgtgtcac      1260
     gtggaggtat cggcgctggc cgtgggcacc aagccacagc cgttccgccg gctgcgctga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page