(data stored in ACNUC30630 zone)

EMBL: CP000113.PE309

CP000113.PE309       Location/Qualifiers
FT   CDS_pept        complement(371187..371873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN56441.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90090"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="InterPro:IPR037181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH8"
FT                   /protein_id="ABF90090.1"
FT                   /translation="MKAPETDEDFIQWYEDCWADRDEVEYPKMFGAIDEGVFTLDQTDA
FT                   IQAWMESELAQVQEADPNWGPMGVRVSPPSESYPYWTYVTSGLSNPFTVAPGEDIPDGA
FT                   PSGLGYEMVIHSPEEAKWPVFRLLDMMAYNLVSLRAFAMGHRYPVEGSLDGGESKLSGF
FT                   VFVRDPSRPDHFVLPSGKVQLLTLVGATRNEMAFARSNGMDKLMAKLVAAGSGYITQPD
FT                   REEVKL"
     atgaaagccc cggagacgga cgaagacttc atccagtggt acgaggactg ctgggcggac        60
     cgcgacgaag tcgagtatcc gaagatgttc ggcgccattg acgaaggcgt cttcacgctc       120
     gaccagacag atgccatcca agcgtggatg gagagtgagc tggcccaggt ccaggaagcg       180
     gaccccaact ggggtcccat gggcgtgcgc gtctccccgc ccagcgagag ctacccctac       240
     tggacctatg tcaccagcgg actgtccaac cccttcaccg tggcgcccgg cgaggacatc       300
     cccgacggcg cgcccagcgg gctgggctac gagatggtca tccactcgcc cgaagaggcg       360
     aagtggccgg tgttccggct gctggacatg atggcctaca acctcgtgtc cctgcgcgcc       420
     ttcgccatgg gccaccgcta cccggtggaa ggctccctgg acggtggcga gtccaagctg       480
     agcggcttcg tgttcgtccg ggacccgtcc cggcccgacc acttcgtgct ccccagcggc       540
     aaggtgcaac tgctcaccct ggtgggcgcc acccgcaacg agatggcctt cgcccgctcc       600
     aacggcatgg acaagctgat ggccaagctg gtggcagcag gctccggcta catcacccag       660
     cccgaccggg aagaagtgaa gttgtag                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page