(data stored in ACNUC30630 zone)

EMBL: CP000113.PE321

CP000113.PE321       Location/Qualifiers
FT   CDS_pept        complement(389769..390998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0333"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86045"
FT                   /db_xref="GOA:Q1DFG6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025511"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG6"
FT                   /protein_id="ABF86045.1"
FT                   /translation="MLKRGWKALAGVTALAAVGCAHAPPPQELLNARAAYQEVSTSPQG
FT                   RERPRDVAAARDALLEAEREYDRSQDSPRTRSLSYVALRKSETAGARGTADLAARRQAE
FT                   AQATLQQAQARQWQRSQAELDAARQQLAQAERERLQALQQQQQSRQHAVTQQQEAERMR
FT                   MDAQRRQHEAEQLRRLAQQQEAESRRLAEKTTRLQEEAQRRARAESESRRLAQENHELL
FT                   QRSAELEAEQEARRQVERELERERQARLDAEQRATEALTQLESTARDVKVREEERGLVL
FT                   TMSGQVLFASNAVDLLPTAREQLTEVAHALKVSDSPMVIEGHTDSMGSDAMNEALSYRR
FT                   AEHVREFLISQGVSRDRIQVRGLGEYRPVANNSTPEGRANNRRVEIILPRGGEEATGGS
FT                   GAEPPTTPRR"
     atgctgaagc gtggatggaa ggccctcgct ggcgtcacgg cgctggccgc cgtggggtgt        60
     gcacacgcac caccgcccca ggagctcctc aacgcgcgcg cggcctacca ggaggtctcc       120
     accagccccc agggccgaga gcgtcctcga gacgtcgcgg cggcgcgaga tgcgctgctg       180
     gaagccgagc gggagtacga ccgcagccag gactctcctc gcacccgctc gctgtcctac       240
     gtggcgttgc gcaagtccga gacggcgggg gcacgcggca ccgcggacct ggcggcgcgg       300
     cgtcaggcgg aggcccaggc cacgctccag caagcgcagg cgcggcagtg gcagcgctcg       360
     caggcggagc tggatgcggc ccggcagcag ctcgcccagg ccgagcgtga gcggctgcaa       420
     gccctccagc aacagcaaca gtcccggcag cacgccgtga cgcagcaaca ggaagccgag       480
     cgcatgcgga tggatgccca gcggcgccag cacgaggcgg aacagctgcg gcggctggcc       540
     cagcagcagg aagcggagtc gcggcggctg gcggagaaga ccacgcggct tcaggaagaa       600
     gcgcaacgcc gggcgcgggc cgagtccgaa tcccggcgac tggcccagga gaaccacgaa       660
     ctgctccagc gctcggcgga gctggaagcg gagcaggagg cacggcgcca ggtggagcgg       720
     gagctggaac gcgagcgaca ggcgcggctc gacgcggaac agcgcgccac ggaggcgctg       780
     acacagttgg agtcgacggc gcgcgacgtg aaggtccgcg aggaggaacg aggcctggtg       840
     ctgacgatgt cagggcaggt gctgttcgcg tcgaacgcgg tggacctgct ccctacggcg       900
     cgtgagcaac tgacggaggt ggcccacgcg ctcaaggtgt ccgacagtcc catggtcatc       960
     gaaggccaca cggattcgat gggctcggac gcgatgaacg aagccctgtc ctaccggcgg      1020
     gcggagcacg tgcgggagtt cctcatcagc cagggcgtga gtcgcgaccg catccaggtg      1080
     cgcggcctgg gcgagtaccg ccccgtcgcc aacaactcca ccccagaggg ccgcgccaac      1140
     aaccggcgcg ttgaaatcat cctcccgcgt ggaggggagg aggccactgg cggcagcggc      1200
     gctgagcccc cgacgacgcc tcggcgctga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page