(data stored in ACNUC30630 zone)

EMBL: CP000113.PE34

CP000113.PE34        Location/Qualifiers
FT   CDS_pept        complement(43910..44689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0037"
FT                   /product="putative aliphatic sulfonates ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to GB:BAD39859.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90578"
FT                   /db_xref="GOA:Q1DGA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA3"
FT                   /protein_id="ABF90578.1"
FT                   /translation="MVALQNVDLNVRSGEFVCLLGPSGCGKSTLLYALAGHVVPTGGSV
FT                   SIDRHPIHGPGPDRLLMFQEAALFPWLTVRGNITFALAARGVPRAERRERADTYIRRVQ
FT                   LGGFEDALPHQLSGGMKMRASLARALAVDPAVLLMDEPFGSLDAQTRIHMQELLQSIWV
FT                   RTGKTVVFVTHDVHEALMLGTRVVLMAPRPGRVVRDLEVHLPMPRQPEDAALNEMVRHV
FT                   GGLLREVEGRAHTRSLQPAPTRAPAQPVLRPQVIPGP"
     gtggtcgcct tgcagaacgt ggacctcaac gtccgctcgg gcgaattcgt gtgcctgctg        60
     ggcccgtccg gctgcggcaa gtccacgctg ctctacgcgc tggcggggca cgtggtgccc       120
     acggggggct cggtgtccat cgaccggcat cccatccacg ggcccgggcc ggaccggctg       180
     ctgatgttcc aggaggccgc cctgttcccg tggctcaccg tgcgcggcaa catcaccttc       240
     gcgctggccg cccggggcgt gccccgcgcc gagcgccgcg agcgggcgga cacctatatc       300
     cggcgcgtgc agttgggcgg cttcgaggac gcgctgcccc accaactctc cggcggcatg       360
     aagatgcggg cctcgctcgc ccgggcgctg gcggtggacc cggccgtgct gctgatggac       420
     gagcccttcg gttcgctgga cgcgcagacg cgcatccaca tgcaggagct cctccagtcc       480
     atctgggtgc gcacaggcaa gacggtggtg ttcgtcaccc atgacgtcca tgaagcgctg       540
     atgctgggca cccgcgtggt gctgatggcg ccccggccgg gacgcgtggt gcgggatttg       600
     gaagtccacc tgcccatgcc gcgccagccg gaggacgcgg cgctcaatga aatggtgcgg       660
     cacgtcggcg gcctgctgcg tgaggtggag ggccgcgccc acacacgctc gctccagcca       720
     gcgcccaccc gggcccccgc ccagcccgtg ctccgtccgc aggtgattcc cggcccgtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page