(data stored in ACNUC30630 zone)

EMBL: CP000113.PE343

CP000113.PE343       Location/Qualifiers
FT   CDS_pept        416848..418464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0355"
FT                   /product="putative pilus biogenesis operon protein"
FT                   /note="This and adjacent genes have similarity to the TadE
FT                   family of pilus biogenesis genes."
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91767"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE4"
FT                   /protein_id="ABF91767.1"
FT                   /translation="MTHKLLSRGQTLVLFALTLLLLTLLVTLTLSFGSKVKEKMEVQAA
FT                   ADAAAYSQAATTARVFNEMALMSRAQIGHLVSKAAVNSLIDWSSYYRAQIGATRNAYTI
FT                   AMLPYIALLPCCIPYSGCSSFCRCAIQGVRDITRSQNALSRYDRTEIAPQWDQLERPAA
FT                   QRALRLSQAAQQMFVVGQVVQYGRMMLELNNQSAANDIIDSAGAGSRWAGELRVDGVST
FT                   TRREVAPYLGAVAWPNLINGHHVYAAMGSRGHSFVANRGIFPTDDWLVTAGIQRRLTTP
FT                   DTVMIQGDGSTYWARTPLHGTYLGTTDTYSIADDHGLAFVTFARGRSPCPTQTFGIGVA
FT                   ESLLIASDSSDPRDRHRWSPRLGTGDLEPAQTRHNMGTCYGRNRMGCPSVWPMFVDYNG
FT                   VKVMDKDDNWGQPKNFAVIQRDYAVRGTQADPWNLLFRFRFGGTDSGFDNSGLVLGPAG
FT                   GGLNISRQTAVSTGLAYYHRREHWREPPNLLNPYWRATLVPATVDSSGAEDFVDELNGA
FT                   GVGWAAEAYEALRAQGYRGGP"
     atgacgcaca agctactgag ccgcggacag acgctggtgc tgttcgcctt gacgctgttg        60
     ctcctcaccc tgctggtgac cttgacgttg tcgtttggct ccaaggtgaa ggagaagatg       120
     gaggtccagg ccgcggcgga tgccgctgcc tacagccagg cggcgacgac ggcgcgcgtc       180
     ttcaacgaga tggccttgat gagccgggcg cagattggcc acctggtctc caaggccgcg       240
     gtgaacagcc tcatcgactg gagcagctac taccgcgcgc agattggcgc cacgcggaat       300
     gcctacacca tcgcgatgct tccctacatc gcgttgttgc cgtgctgcat tccctattcg       360
     gggtgcagca gcttctgcag gtgcgccatc cagggcgtcc gggacatcac ccgcagccag       420
     aacgcgctct ctcgctacga ccggacggag attgctcctc agtgggatca gctcgagcgg       480
     cccgccgcgc agcgagcgtt gcggctcagc caggccgcgc agcagatgtt cgtcgtgggg       540
     caggtcgtcc agtacgggcg catgatgctc gaattgaaca accagtccgc cgcgaacgac       600
     atcatcgaca gcgccggcgc gggcagccgc tgggcggggg agctccgagt ggatggggtc       660
     tccaccacgc gccgcgaggt ggcgccctac ctgggggccg tggcgtggcc caacctcatc       720
     aacgggcatc acgtctacgc ggccatgggc agccgggggc acagcttcgt cgccaaccgt       780
     ggcatcttcc ccactgatga ctggctcgtc acggcgggta tccagcggcg gttgactacc       840
     ccggacacgg tgatgattca gggggatggc agcacctact gggctcgcac gccgcttcat       900
     ggcacgtatc tgggcacgac ggacacgtac tccatcgcgg atgaccatgg tctggccttc       960
     gtcaccttcg cccgtggccg gtccccgtgc cccacgcaga cttttggaat cggtgtcgcg      1020
     gagtcgctgc tcatcgcctc ggattcgagc gaccccaggg accggcaccg ctggtctccg      1080
     cgcctgggaa cgggtgacct ggagccggcg cagacgcgtc acaacatggg gacctgttat      1140
     ggccgcaatc ggatggggtg cccgtccgtc tggcccatgt tcgtcgacta caacggcgtc      1200
     aaggtcatgg acaaggatga caactggggc cagccgaaga acttcgcggt catccagcgg      1260
     gactatgccg tgcgtggcac ccaggcggac ccctggaacc tgctgttccg cttccggttc      1320
     ggggggacgg acagcgggtt cgacaacagc ggactcgtcc tggggccggc gggcggcggg      1380
     ttgaacatca gccgccagac ggcggtgtcc accgggctgg cctactacca tcgtcgcgag      1440
     cactggcgcg agcctcccaa tctgctcaat ccgtactggc gcgccacgtt ggtccccgcc      1500
     accgtggact ccagcggcgc ggaggatttc gtggacgagc tgaacggcgc cggcgtgggc      1560
     tgggcggcgg aggcatacga ggccctgcgt gcacagggct acaggggagg gccgtga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page