(data stored in ACNUC30630 zone)

EMBL: CP000113.PE35

CP000113.PE35        Location/Qualifiers
FT   CDS_pept        44867..45361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87699"
FT                   /db_xref="GOA:Q1DGA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA2"
FT                   /protein_id="ABF87699.1"
FT                   /translation="MRASWPARLLCARRGARGPRPLSHPVEPGDASDACFHRLPVCLRH
FT                   GGMLEDDGIIKLMRGVLATYSDKSRFGAAGLMLLLGLGVLLGAGSLALSAEPLIDDEWL
FT                   AWPVGLLAPFVVGAVVAGFQKVKLWDWKFRFDLERFGAAFCVTTGFVLARFVGVPLLAG
FT                   G"
     ttgagggctt catggcctgc tcgcctgctt tgcgcgcgga gaggggctcg tggcccgcgg        60
     cctttgtccc acccagtaga acctggtgac gcttcagacg cgtgttttca tcgcctgccc       120
     gtctgtctta gacatggggg catgctggag gacgacggga ttatcaagct gatgcggggc       180
     gttctggcga cctactcgga caagagccgc ttcggcgccg ccgggctgat gctcctgctg       240
     ggcctgggcg tgctgctggg ggcgggcagc ctggccctct ccgccgagcc cctcatcgac       300
     gacgagtggc tggcgtggcc cgtgggattg ctggccccct tcgtcgtggg cgccgtcgtg       360
     gccggcttcc agaaggtgaa gctgtgggac tggaagttcc ggttcgacct ggagcgcttc       420
     ggcgcggcct tctgcgtcac gacgggcttc gtgctggccc gcttcgtcgg cgtcccgctg       480
     ctcgccgggg gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page